PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT04645
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 329aa    MW: 35670.5 Da    PI: 8.0997
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT04645genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.51.5e-331973155
   G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
              kprlrWtp+LHerFveav++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYR+
  EMT04645 19 KPRLRWTPDLHERFVEAVTKLGGPDKATPKSVLRLMGMKGLTLYHLKSHLQKYRM 73
              79****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-321674IPR009057Homeodomain-like
PROSITE profilePS5129413.7161676IPR017930Myb domain
SuperFamilySSF466891.79E-161975IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-241974IPR006447Myb domain, plants
PfamPF002491.1E-92172IPR001005SANT/Myb domain
PfamPF143791.1E-24118162IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MERAGYGVGA GVVLSRDPKP RLRWTPDLHE RFVEAVTKLG GPDKATPKSV LRLMGMKGLT  60
LYHLKSHLQK YRMGKQSKKD TGFETNRGAF AAQGISFSSA VPPNVPSAGN SNMGETPLAD  120
ALRYQIEVQR KLHEQLEVQK KLQMRIEAQG KYLQTILEKA QKNLSYEAGG DATLETTRSQ  180
LTDFNLALSG FMDDATQACQ QNGGELAKAL SDDGLRAGNL GFQLYHGGDD VKCATDEDLL  240
LLDLNIKGGY DHRLSAHGMP RGAVDLTVGQ HRSRWHITPN SSNAGVSLPL LITDAIVANI  300
NDAAPKMALL YAIVTITGRV EATDNEGCA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-211975157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-211975157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-211975157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-211975157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3569260.0AK356926.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1042E14.
GenBankAK3660410.0AK366041.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2039P18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020170372.10.0myb family transcription factor PHL11-like
SwissprotC0SVS42e-64PHLB_ARATH; Myb family transcription factor PHL11
TrEMBLM8ASG00.0M8ASG0_AEGTA; Myb family transcription factor APL
STRINGEMT046450.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39403470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.13e-65G2-like family protein
Publications ? help Back to Top
  1. Petridis A,Döll S,Nichelmann L,Bilger W,Mock HP
    Arabidopsis thaliana G2-LIKE FLAVONOID REGULATOR and BRASSINOSTEROID ENHANCED EXPRESSION1 are low-temperature regulators of flavonoid accumulation.
    New Phytol., 2016. 211(3): p. 912-25
    [PMID:27125220]