PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT04610
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family ZF-HD
Protein Properties Length: 134aa    MW: 14769.3 Da    PI: 11.8005
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT04610genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer54.92e-172858333
  ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpseg 33
                  v+YkeC++NhAa +Gg+avDGC+Efm+s+ 
     EMT04610 28 VVHYKECQRNHAAGIGGYAVDGCREFMASRP 58
                 689*************************954 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257746.0E-82756IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.8E-142961IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152315.9083185IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 134 aa     Download sequence    Send to blast
MGPQQDRSAS KALANGTAVA PERKDGKVVH YKECQRNHAA GIGGYAVDGC REFMASRPRG  60
RRGAPLRGVR LPPQLPQARG GGRRLRLLLR HLRPVIAAAR RCPSLLFSCW LVRVDRHRQI  120
CASCLEPAVN KICL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3604211e-167AK360421.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1117M15.
GenBankAK3613571e-167AK361357.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1138M11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM8ASB29e-91M8ASB2_AEGTA; Uncharacterized protein
STRINGEMT046102e-91(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.14e-12mini zinc finger 2