PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT03073
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family GRAS
Protein Properties Length: 649aa    MW: 72721.9 Da    PI: 5.5989
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT03073genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS317.92.1e-972706402373
      GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
               + lLl cA+ v++g+ + a +lL++++++as +gd+ qRla +f+++L+arla+++s++y++l +++ts   + e l+ ++lf  ++ + ++++     +I
  EMT03073 270 RGLLLCCAQEVATGNRHGAGNLLKQIRQHASATGDAAQRLAYCFAKGLEARLAGTGSQVYRSLMAKHTS---TMEFLKGYELFMAACSFKRVAFTFSSMTI 367
               679************************************************************999999...899************************** PP

      GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEa 201
                +aveg++++Hi+D+++ +G QWp Ll  La+R++gpp++RiTg++ p++g   +++leetg+ L++ A+++g+pf+f++ +a ++e+++ e+L+++p+E+
  EMT03073 368 FDAVEGKSKLHIVDYGLHYGCQWPGLLAWLATRDGGPPEVRITGIDLPQPGfrPAKRLEETGRALSNCARQFGLPFKFHA-IAAKWETIRAEDLNIDPDEV 467
               **************************************************9*****************************.799***************** PP

      GRAS 202 laVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvac 300
               l+Vn  ++  +l+des+ ++   +rd vL+ +++++P+v++    + +  ++ Fl+rf eal +ys++fd+l+a+ p++s +r ++Er ++g+ + n +ac
  EMT03073 468 LVVNDLFNFNTLMDESLVIDRpsPRDVVLSNIREMQPDVFIQGVVNGSS-GPFFLARFREALFFYSSVFDMLDATTPPDSYQRFVLERDMFGQCALNTIAC 567
               ****************98877669****************998888776.89************************************************* PP

      GRAS 301 egaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
               e a+r+er et+++W+ r ++aG++++pl+  ++k a+  ++  + +++ v+ ++g+l++gWk+r L++ SaW
  EMT03073 568 ESADRVERPETYKQWQLRNQRAGLRQLPLKPIITKVASGKVKSLYHKEFVVDVDQGWLLQGWKGRILYAHSAW 640
               *********************************************999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.449243621IPR005202Transcription factor GRAS
PfamPF035147.3E-95270640IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 649 aa     Download sequence    Send to blast
MPIAREELLG LKEHMEPPPP SPSVYLDIPP SPCGGSVGDL VLPYITRILM EEDIDDRFFY  60
QYPDHLAFLQ AQQQFTQILD DAKNLPSCEG GDMEKMHSDA SLQGIRGGSM CLADKDVPSW  120
TFSDGAEVDN NGDQSKLNRS NEAMLNFAFL KGMEEANKFL PRDNQPQADV FSVDQAKEIF  180
GRSISGGARK GQRDVDKLEE VVGRSSKLLM PELEEDGARE MINKIMLNSY ELCGETMEKL  240
QITMENIRAD RKNKKAVRGK QGKKEAVDLR GLLLCCAQEV ATGNRHGAGN LLKQIRQHAS  300
ATGDAAQRLA YCFAKGLEAR LAGTGSQVYR SLMAKHTSTM EFLKGYELFM AACSFKRVAF  360
TFSSMTIFDA VEGKSKLHIV DYGLHYGCQW PGLLAWLATR DGGPPEVRIT GIDLPQPGFR  420
PAKRLEETGR ALSNCARQFG LPFKFHAIAA KWETIRAEDL NIDPDEVLVV NDLFNFNTLM  480
DESLVIDRPS PRDVVLSNIR EMQPDVFIQG VVNGSSGPFF LARFREALFF YSSVFDMLDA  540
TTPPDSYQRF VLERDMFGQC ALNTIACESA DRVERPETYK QWQLRNQRAG LRQLPLKPII  600
TKVASGKVKS LYHKEFVVDV DQGWLLQGWK GRILYAHSAW VADDTSSEY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-402736408374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575617.30.0PREDICTED: scarecrow-like protein 9
TrEMBLR7W0X60.0R7W0X6_AEGTA; Uncharacterized protein
STRINGBRADI4G09170.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-135GRAS family protein