PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT03072
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family GRAS
Protein Properties Length: 1165aa    MW: 131134 Da    PI: 6.3745
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT03072genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS296.66.3e-911955312340
      GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
                +lL++cA+av + d + a +lL++++++asp+gd++qRla  f+e+L+arl++++s++y  l+++ ts   ++++++a++lf  ++ + k+++l aN+aI
  EMT03072 195 HTLLIHCAKAVMD-DRRSAGELLKEIKQHASPTGDATQRLAYWFAEGLEARLTGTGSQVYGLLTAECTS---TVRHMQAYQLFMSTCCFRKVAFLFANKAI 291
               679********97.8999******************************************999998888...899************************** PP

      GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEa 201
                +a+ g++r+Hi+D+++  G+QWp Ll+ LasR++gpp++RiT v+ p++g   ++ +e++g+rL+++A+elgvpf++++ ++ +++++ +e+L+++p+Ea
  EMT03072 292 FNAAVGKSRLHIVDYGLHSGFQWPELLRWLASRDGGPPEVRITHVELPQPGvyPEKHMEQIGNRLTDIAQELGVPFKYRA-IMAQWQTICVEDLDMEPDEA 391
               ********************************************************************************.6999**************** PP

      GRAS 202 laVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvac 300
               laVn +++  +l+desv ++s  +rd+vL  + +++P+v+v +  + ++ ++ Fl rf eal y+salfd+l+a++pres+ r  +Er ++g+ + n++a 
  EMT03072 392 LAVNDQFNFRTLMDESVVIASpnPRDAVLGNISKMKPDVFVQSTVNGSY-GTFFLSRFREALFYHSALFDMLDATMPRESKLRLALERDVFGWMVLNAIAY 491
               *****************9998889***********************99.789************************************************ PP

      GRAS 301 egaerrerhetlekWrerleeaGFkpvplsekaakqakll 340
               eg++r+er et+++W+ r ++aG++++pl+ +++k a+ +
  EMT03072 492 EGEDRVERGETYKHWQIRNQRAGLRQLPLNRETVKMARDM 531
               ********************************99999876 PP

2GRAS316.27e-9778511572374
      GRAS    2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100 
                 +lL++cA+av + d ++a +lL++++++asp+gd++qRla  f+e+L+arl++++s++y +l+++ ts    + +  a++ f  ++ + ++s+l aN+
  EMT03072  785 HTLLIHCAKAVMD-DRRRAGELLKEIQQHASPTGDATQRLAYWFAEGLEARLTGTGSQVYGTLTAKGTS---AVAHSEAYQEFISACCFRNVSFLFANS 879 
                679********97.999**********************************************999999...899999********************* PP

      GRAS  101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeL..r 195 
                aI +a+ g +r+Hi+D++  +G+QW  Ll+ La+R++gpp++RiT ++ p++g   ++ +ee+g rL+ +A+elgv+f++++ +  +++++++e+L  +
  EMT03072  880 AIFNAAVGRSRLHIVDYGFRYGFQWSELLRRLAARDGGPPEVRITHIDLPQPGfhPEKHMEEIGYRLTGIARELGVSFKYRA-ILAQWQTVSIEDLdlD 977 
                ****************************************************9999**************************.6889999999998334 PP

      GRAS  196 vkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292 
                ++p+E+laVn  ++  +l+desv + s  +rd+vL  + +++P+v+v +  + ++ ++ Fl rf eal +ysalfd+l+a++pre++ r  +Er ++g+
  EMT03072  978 LEPDEVLAVNDLYNFRTLMDESVVIGSpnPRDTVLGNISKMKPDVFVQSTVNGSY-GTFFLSRFREALFFYSALFDMLDATMPRENKLRLALERNIFGW 1075
                566********************9988779***********************99.789**************************************** PP

      GRAS  293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374 
                 + n++a eg++r+er+et+++W+ r ++aG++++pl+ +++k a+ ++++ + + + ++e++++l++gWk+r L++ S W+
  EMT03072 1076 VVLNAIAYEGTDRVERCETYKHWQVRNQRAGLRQLPLDRETVKMARDMVKNKYHKDFLIDEDHHWLLQGWKGRILLAHSTWE 1157
                ***************************************************99888*************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.769168545IPR005202Transcription factor GRAS
PfamPF035142.2E-88195531IPR005202Transcription factor GRAS
PROSITE profilePS5098555.7367581137IPR005202Transcription factor GRAS
PfamPF035142.4E-947851157IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 1165 aa     Download sequence    Send to blast
MADDDSNCFA VQDHLALPYI TQILMEEEDD VDEDNPALLK AQRPFAQILS SSMHASTLMA  60
DQGGALALDV HSPSSPIFKF KGVDEVRSLL LLPDGDYSTH MFSTAFLRGM EEANKFLPTN  120
CELTTTGGHD QPKEKSGRGR KDRHGEVEAD VSRTSRLVEA GAGEVFDQML TAMGNETGNS  180
NKKGRKSKAR VVDLHTLLIH CAKAVMDDRR SAGELLKEIK QHASPTGDAT QRLAYWFAEG  240
LEARLTGTGS QVYGLLTAEC TSTVRHMQAY QLFMSTCCFR KVAFLFANKA IFNAAVGKSR  300
LHIVDYGLHS GFQWPELLRW LASRDGGPPE VRITHVELPQ PGVYPEKHME QIGNRLTDIA  360
QELGVPFKYR AIMAQWQTIC VEDLDMEPDE ALAVNDQFNF RTLMDESVVI ASPNPRDAVL  420
GNISKMKPDV FVQSTVNGSY GTFFLSRFRE ALFYHSALFD MLDATMPRES KLRLALERDV  480
FGWMVLNAIA YEGEDRVERG ETYKHWQIRN QRAGLRQLPL NRETVKMARD MVMVWWIHAI  540
LARKMKFKIG SKKACRFKVL MVLRVYAVQA IGGSGLEIPN DYYIQDWLEG LAVKDRRSGV  600
DHLALPNIAR ILMEEEDDID EDNPALLKAQ RPFAQILSSS MHASTLMADQ GGALASDMHS  660
PSSGISKFKG VDDVRSLLLL ANGEFSTDIF STAFLKGMEE AKKFLPTNSE LTATGEQDQP  720
KEKSSRGRKD WSDEVEADFS RTDRLVEAGA CEVFDFNQMC SSMDNETGNS NKKGRKSKAR  780
VIDLHTLLIH CAKAVMDDRR RAGELLKEIQ QHASPTGDAT QRLAYWFAEG LEARLTGTGS  840
QVYGTLTAKG TSAVAHSEAY QEFISACCFR NVSFLFANSA IFNAAVGRSR LHIVDYGFRY  900
GFQWSELLRR LAARDGGPPE VRITHIDLPQ PGFHPEKHME EIGYRLTGIA RELGVSFKYR  960
AILAQWQTVS IEDLDLDLEP DEVLAVNDLY NFRTLMDESV VIGSPNPRDT VLGNISKMKP  1020
DVFVQSTVNG SYGTFFLSRF REALFFYSAL FDMLDATMPR ENKLRLALER NIFGWVVLNA  1080
IAYEGTDRVE RCETYKHWQV RNQRAGLRQL PLDRETVKMA RDMVKNKYHK DFLIDEDHHW  1140
LLQGWKGRIL LAHSTWEADG ASSHC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-4019811568374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014758581.10.0PREDICTED: scarecrow-like protein 14
TrEMBLR7W4N30.0R7W4N3_AEGTA; Uncharacterized protein
STRINGMLOC_43730.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-117SCARECROW-like 14