PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT03071
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family GRAS
Protein Properties Length: 631aa    MW: 70132.6 Da    PI: 5.4253
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT03071genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS328.41.4e-10026362511373
      GRAS  11 avssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeer 111
               a+s+++ + a++lL+r++++++p+gd+ qRla+yf+eAL arla+ +sely++l +++ts   +++ l+a +l+  ++ + k++++ aN++I +av g++r
  EMT03071 263 ALSTDNRRTASELLKRIRQHSTPKGDAAQRLAHYFAEALDARLAGRGSELYQSLMARRTS---VADFLKANQLYMAACCCKKVAFIFANKTICNAVVGKSR 360
               68999***************************************************9999...************************************** PP

      GRAS 112 vHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlql 210
               +Hi+D+++sqGlQWp Ll+ La+R++gpp+++iTg++ p++g   +  +eetg+rL++fA+ +gvpf+f+  +a + e++++e+L+++++E+l+V +  + 
  EMT03071 361 LHIVDYGLSQGLQWPGLLRMLAAREGGPPEVKITGIDLPQPGfhGAYHIEETGRRLSNFARVFGVPFKFHG-IAAKRETVQPEDLNIDRDEVLVVISLCHF 460
               *****************************************999999************************.69999**********************99 PP

      GRAS 211 hrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerh 309
                 l+de++  +   +rd+vL+ +++++P+v+++   + +++++ Fl+rf eal  ysa fd l+a++pr++e r  +Er ++gr++ nv+acega+r+er 
  EMT03071 461 RLLMDENLGFDTpsPRDQVLNNIRKMRPDVFIHGIMNGSYGATYFLTRFREALFNYSAQFDLLDATVPRDNEGRLLLERDIFGRSALNVIACEGADRVERP 561
               99999998655444*************************************************************************************** PP

      GRAS 310 etlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
               et+++W+ r ++aG++++pl+ +++  +   ++  + + + v+e++ +l+  Wk+r L+++S W
  EMT03071 562 ETYKQWQLRNHRAGLRQLPLNPDVVRLVLDKVKDNYHKDFVVDEDQRWLLHRWKGRVLYALSTW 625
               *********************************999888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.636227606IPR005202Transcription factor GRAS
PfamPF035144.9E-98263625IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 631 aa     Download sequence    Send to blast
MAATPEEFLG QQGFLARLEP PSPSLFLGLP PTPRGEEDGD SSFDDMALPY ISRLLEEDME  60
DHFFYLYPNH PALLRAQLPF AQILVDVADS ASGSTSALSP SSSTSTFDAT ASTTPSATSP  120
YDAAIQISRP PYAQVLGLAS GSPDTQSSAL LSCDEEAQNP SSDFVIGNYL LPGDQDMLNL  180
AFLKGMEEAS KFLPPNSSLP AMKVDQVVGG ALAGAGLKKK RDTLDPDMGR ASKLMMPEQE  240
EDGARELFDE MMFQENEICM KGALSTDNRR TASELLKRIR QHSTPKGDAA QRLAHYFAEA  300
LDARLAGRGS ELYQSLMARR TSVADFLKAN QLYMAACCCK KVAFIFANKT ICNAVVGKSR  360
LHIVDYGLSQ GLQWPGLLRM LAAREGGPPE VKITGIDLPQ PGFHGAYHIE ETGRRLSNFA  420
RVFGVPFKFH GIAAKRETVQ PEDLNIDRDE VLVVISLCHF RLLMDENLGF DTPSPRDQVL  480
NNIRKMRPDV FIHGIMNGSY GATYFLTRFR EALFNYSAQF DLLDATVPRD NEGRLLLERD  540
IFGRSALNVI ACEGADRVER PETYKQWQLR NHRAGLRQLP LNPDVVRLVL DKVKDNYHKD  600
FVVDEDQRWL LHRWKGRVLY ALSTWVADNA T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-4025962511374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3664420.0AK366442.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2043B18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575618.10.0PREDICTED: scarecrow-like protein 9 isoform X2
RefseqXP_014758580.10.0PREDICTED: scarecrow-like protein 9 isoform X2
SwissprotO809331e-132SCL9_ARATH; Scarecrow-like protein 9
TrEMBLR7W5Z40.0R7W5Z4_AEGTA; Uncharacterized protein
STRINGBRADI4G09180.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-129GRAS family protein