PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT03070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family GRAS
Protein Properties Length: 675aa    MW: 75081.2 Da    PI: 6.8566
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT03070genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS336.16.2e-1032986692373
      GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
                +lLl+cA+a+s+++ + a +lL+r+++++sp+gd+ qRla+yf+++L+arla+ +sely++l  s+ s   +++ l+a +l+  ++ + k++++ a ++I
  EMT03070 298 HTLLLNCAQALSTDNRQSAIELLKRIRQHSSPKGDAGQRLAHYFANGLEARLAGRGSELYQSLLLSRIS---VADFLKANQLYMAACCCKKVAYIFADKTI 395
               679************************************************************999998...***************************** PP

      GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEa 201
                +av+g++r+Hi+D++++qGlQWp Ll+ La+R++gpp++RiTg++ p++g   +  +eetg+rL++fA+ +gvpf+f+  +  + e++++e+L+++++E+
  EMT03070 396 CNAVAGKRRLHIVDYGLNQGLQWPGLLRMLAAREGGPPEVRITGIDLPQPGfhGAYHIEETGRRLSNFARVFGVPFKFRG-IPAKRETVRPEDLNIDRDEV 495
               **************************************************999999************************.69999*************** PP

      GRAS 202 laVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvac 300
               l+V +  q  +l+des+  +   +rd+vL+ +++++P+v+++   + +++++sFl+rf eal +ysa fd l++++pr++e r  +Er ++gr+  nv+ac
  EMT03070 496 LVVISLCQFRHLMDESLGFDGpsPRDQVLNNIRKMRPDVFIHGIMNGSYGATSFLTRFREALFHYSAQFDLLDTTVPRDNEGRLLLERDIFGRSCLNVLAC 596
               ****************98876669***************************************************************************** PP

      GRAS 301 egaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
               ega+r+er et+++W+ r ++aG++++pl+ +++k +   ++  + + + v+ ++ +l+  Wk+r L++ S+W
  EMT03070 597 EGADRVERPETYKQWQLRNHRAGLRQLPLNPEVVKLVLDKVKDNYHRNFVVDADQRWLLHRWKGRVLYAWSSW 669
               *********************************************999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.384271650IPR005202Transcription factor GRAS
PfamPF035142.1E-100298669IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 675 aa     Download sequence    Send to blast
MAATPEEFLG QQGFLARLEP PSPSLFLDLP PTPRDDDGHS SFDDMVLPYI SRLLMEEGTE  60
DHLFYLYPNH PAVLRAQQPF AQILVDVADS ASASGSTSSP SPSSSSDATA STTPSTATAS  120
ASASPDDAPV QISRPPYTDV NGHASASPDN HSSGLLNGDE MAKRPSSDFF SHLLPGDQDM  180
LNLAFRKGME EASKFLPPDI SLPPINEGTV VGGGNAVSLK KKRAALPLEP DVGRPSKLMM  240
PEQEERKMFD EMMFQEHEIC MKGTHNLIAA ADGEPGKNSR KKDRSRKAVD DREMVDLHTL  300
LLNCAQALST DNRQSAIELL KRIRQHSSPK GDAGQRLAHY FANGLEARLA GRGSELYQSL  360
LLSRISVADF LKANQLYMAA CCCKKVAYIF ADKTICNAVA GKRRLHIVDY GLNQGLQWPG  420
LLRMLAAREG GPPEVRITGI DLPQPGFHGA YHIEETGRRL SNFARVFGVP FKFRGIPAKR  480
ETVRPEDLNI DRDEVLVVIS LCQFRHLMDE SLGFDGPSPR DQVLNNIRKM RPDVFIHGIM  540
NGSYGATSFL TRFREALFHY SAQFDLLDTT VPRDNEGRLL LERDIFGRSC LNVLACEGAD  600
RVERPETYKQ WQLRNHRAGL RQLPLNPEVV KLVLDKVKDN YHRNFVVDAD QRWLLHRWKG  660
RVLYAWSSWI AADAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-423016698374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3672260.0AK367226.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2053C24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575618.10.0PREDICTED: scarecrow-like protein 9 isoform X2
RefseqXP_014758580.10.0PREDICTED: scarecrow-like protein 9 isoform X2
TrEMBLA0A096URM80.0A0A096URM8_WHEAT; Uncharacterized protein
STRINGMLOC_7746.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-137SCARECROW-like 14