PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT03069
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family GRAS
Protein Properties Length: 799aa    MW: 87783.9 Da    PI: 6.5491
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT03069genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS330.33.7e-1014147891373
      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
               l++ L++cA+av++gd++  ++lL ++++++sp+gd++qRla +f+e+L+arla+++s++y++l +++ts   + e l a+kl+  +s + k+ ++   + 
  EMT03069 414 LRTMLIHCAQAVATGDHRGSNELLRQIKQHSSPKGDATQRLAYCFAEGLEARLAGTGSHVYRSLVAKSTS---VGEFLRAYKLYMAASSFKKVNFIFVGKI 511
               5789***************************************************************999...9*************************** PP

      GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgE 200
               I++a+ g++r+Hi+D+++++G+QWp Llq La+R++gpp++RiTg++ p++g   + ++eetg+rL+k A+e+gvpf+++  +  +le+++ e+L+++p E
  EMT03069 512 IMDAMVGKSRLHIVDYNVEYGFQWPGLLQMLAEREGGPPEVRITGIDVPQPGfrPAFQIEETGRRLSKCAQEFGVPFKYHG-IPAKLETVHAEDLKIDPYE 611
               ***************************************************999***************************.799**************** PP

      GRAS 201 alaVnlvlqlhrlldesvsles.....erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivn 296
               +l+V +++   +l+desv ++      +rd vL  +++++P+v++ +  +  ++++ F++rf eal +ysa fd+l+a++pr++++r  +Er ++g+ + n
  EMT03069 612 VLIVTSQYGFSNLMDESVIMDRqdipsPRDMVLTNIRKMRPDVFIDCVVNGTYSAPFFVTRFREALFTYSAQFDMLDATIPRDNDDRLLIERDIFGPCALN 712
               **************99987665556669************************************************************************* PP

      GRAS 297 vvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
               v+acega+r+ r et+++W+ r ++aG+++vpls  ++k +k  ++  + + + ++ ++ +l++gWk+r L+++S W
  EMT03069 713 VIACEGADRVDRPETYKQWQVRGHRAGLRQVPLSPAVVKLVKDKVKSLYHKDFLIDVDNRWLLQGWKGRVLYAMSTW 789
               *************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.972388770IPR005202Transcription factor GRAS
PfamPF035141.3E-98414789IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 799 aa     Download sequence    Send to blast
MAATPDEFLR AGDAEPFSPS LFLDLPPTPS PPRAPASDDL DFISRMLMEE DIDDKFFYQY  60
PDHPAILSAQ HHFAQIISDS NTDDSANTAV ASSTFSSDSA TARSASSCSD SATNTGKSTS  120
SSHSATNTAH STSCSSSPGA LGPANPTWPY ERIDLSQPLH SPPYIGLGFP VDGANNLLFS  180
GVGTPTSGYF GHTPALSRGN NDHFVAPAGQ NGRSTGIQSF ATFANSSAAK DAKTLSNNGT  240
EKAAKPATQP ACRGGPGTPA SAFFNGQTDG DVDMLNMAFR KGMEEANKFL PTNNTLDAIS  300
NRPVPRDFTG DQLKKEEVDR LRMLMFSNGR GRKNRHGVED LEAEAGRRCK LMMPEQEETG  360
VGEMVEEIML HGHDIIMKGI EDLHIAMGTE AEKNHRKGTG KAARGRRGAS EVDLRTMLIH  420
CAQAVATGDH RGSNELLRQI KQHSSPKGDA TQRLAYCFAE GLEARLAGTG SHVYRSLVAK  480
STSVGEFLRA YKLYMAASSF KKVNFIFVGK IIMDAMVGKS RLHIVDYNVE YGFQWPGLLQ  540
MLAEREGGPP EVRITGIDVP QPGFRPAFQI EETGRRLSKC AQEFGVPFKY HGIPAKLETV  600
HAEDLKIDPY EVLIVTSQYG FSNLMDESVI MDRQDIPSPR DMVLTNIRKM RPDVFIDCVV  660
NGTYSAPFFV TRFREALFTY SAQFDMLDAT IPRDNDDRLL IERDIFGPCA LNVIACEGAD  720
RVDRPETYKQ WQVRGHRAGL RQVPLSPAVV KLVKDKVKSL YHKDFLIDVD NRWLLQGWKG  780
RVLYAMSTWV AGDHDNSKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-374187898374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3649830.0AK364983.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2030A10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564369.10.0PREDICTED: scarecrow-like protein 34
TrEMBLR7W0I80.0R7W0I8_AEGTA; Uncharacterized protein
STRINGMLOC_74705.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-141GRAS family protein