PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT03062
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 214aa    MW: 23289.9 Da    PI: 10.3722
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT03062genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.81.4e-292072254
   G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54
              pr++Wt eLH++F++a+e LGG+++AtPk +l++m+vk Lt++hvkSHLQ+YR
  EMT03062 20 PRMQWTAELHRSFLQAIECLGGEHNATPKLVLKVMGVKELTISHVKSHLQMYR 72
              9**************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-271672IPR009057Homeodomain-like
SuperFamilySSF466894.48E-151772IPR009057Homeodomain-like
TIGRFAMsTIGR015575.9E-232072IPR006447Myb domain, plants
PfamPF002495.0E-72172IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MGSSAKKQEA VRRYVRSRAP RMQWTAELHR SFLQAIECLG GEHNATPKLV LKVMGVKELT  60
ISHVKSHLQM YRGPSTRKAK REAQPGLQRR HSCAADEQGG APFMCPPLKR ARTGAGTEAA  120
GEGMQGGQSQ GISGMKTSGA VNRYCIDDYY MQAMAMERRI MEGLSGWQRE GGAAGGGCRA  180
RNGGPQRLAE GCCCCGCCFR PPDRGMLGAR IRRL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-162177460Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-162177460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-162177460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-162177460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-162177460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-162177460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-162177460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-162177460Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020185290.11e-119putative Myb family transcription factor At1g14600
TrEMBLR7W4M61e-154R7W4M6_AEGTA; Putative Myb family transcription factor
STRINGEMT030621e-155(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29663583
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.19e-28G2-like family protein