PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT02870
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family CO-like
Protein Properties Length: 228aa    MW: 23499 Da    PI: 6.9104
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT02870genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.12.7e-061456542
  zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
               C+ ++   + l+C  +   lC  C  + H+       H++vpl
  EMT02870 14 ACAVCGGA-AALYCPADAAALCVPCDAAVHSAnplasrHERVPL 56
              6******9.*********************66999999999986 PP

2CCT66.19.9e-23144187144
       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
               R+++++RY+eKrk+RkF K+irY+sRKa+Ae RpR+KGrFvk++
  EMT02870 144 RAERVRRYREKRKNRKFHKTIRYASRKAYAEARPRIKGRFVKRP 187
               99****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.7411056IPR000315B-box-type zinc finger
SMARTSM003362.2E-131056IPR000315B-box-type zinc finger
CDDcd000219.51E-82456No hitNo description
PROSITE profilePS5101716.271144186IPR010402CCT domain
PfamPF062036.0E-18144186IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MESEGSTSPN GGAACAVCGG AAALYCPADA AALCVPCDAA VHSANPLASR HERVPLAAAV  60
AATSGVYDLF AADEEGGSSW PTPGQGSPNS GSSGFSNNGS GIEMSLFDLL SDVDLPGLAA  120
DGSAAWASSW SPSEAVVVPS AADRAERVRR YREKRKNRKF HKTIRYASRK AYAEARPRIK  180
GRFVKRPAAA ADDGDNTSAG EAAAKFWLSF SDNSVGFQVA SHGVVPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3658981e-114AK365898.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2038L04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003571579.11e-63PREDICTED: zinc finger protein CONSTANS-LIKE 2-like
SwissprotQ9SK531e-35COL3_ARATH; Zinc finger protein CONSTANS-LIKE 3
TrEMBLR7W1701e-163R7W170_AEGTA; Uncharacterized protein
STRINGMLOC_51238.11e-114(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP130662224
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.13e-11CONSTANS-like 5