PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT02164
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 321aa    MW: 34830 Da    PI: 10.4602
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT02164genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.71.1e-274195156
   G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56
              k++++WtpeLH+rFv+aveqL G++kA+P++ile+m++++Lt+++++SHLQkYR++
  EMT02164 41 KAKVDWTPELHRRFVQAVEQL-GIDKAVPSRILEIMGINSLTRHNIASHLQKYRSH 95
              6799*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.6523897IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-273998IPR009057Homeodomain-like
SuperFamilySSF466895.91E-193998IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-264195IPR006447Myb domain, plants
PfamPF002493.8E-84493IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGGGDRPIVP DAKSPSSTTS SSTEAESRHK SSSKNSHGKK KAKVDWTPEL HRRFVQAVEQ  60
LGIDKAVPSR ILEIMGINSL TRHNIASHLQ KYRSHRKHMI AREAEAASWT QRRQMYAAGG  120
PAAAVKRQDS NMWTVPTIGF APAHPPPPPP PSPAAMQHYA RPLHVWGHPT MDSPRMPMWP  180
RHTISRAPMP AWAPPPPPPS DPAFWHHPYM RGPAAYMPTH GTPCMAMPMT PKFPAPPVPV  240
AMPCTVYAPP SPAPALASKN QQDSQLQLQA QPSNESIDAA IGDVLSKPWL PLPLGLKPPS  300
LGSVMGELER QGVANVPQAC G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-163893257ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1054060.0EF105406.1 Triticum aestivum golden 2-like protein (Glk1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563963.11e-138PREDICTED: probable transcription factor GLK1 isoform X1
SwissprotQ5Z5I41e-118GLK1_ORYSJ; Probable transcription factor GLK1
TrEMBLR7VZU40.0R7VZU4_AEGTA; Two-component response regulator-like APRR2
STRINGMLOC_43537.11e-159(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24153886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.13e-54GBF's pro-rich region-interacting factor 1