PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT01045
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 338aa    MW: 36514.6 Da    PI: 5.6045
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT01045genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.91.7e-3147101155
   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
               ++rlrWt eLH +F+eav++LGG+++AtPk il++m+v+gLt++hvkSHLQkYRl
  EMT01045  47 RQRLRWTDELHGCFLEAVTRLGGPDRATPKGILRTMGVQGLTIYHVKSHLQKYRL 101
               58****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.48844104IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-3046102IPR009057Homeodomain-like
SuperFamilySSF466892.15E-1746101IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-2548102IPR006447Myb domain, plants
PfamPF002493.0E-749100IPR001005SANT/Myb domain
PfamPF143791.0E-21133179IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MYEPKPFSST GSAHSNPISH DQQIGPTANN AASSIGGNSS NNSFATRQRL RWTDELHGCF  60
LEAVTRLGGP DRATPKGILR TMGVQGLTIY HVKSHLQKYR LAKYIPDPTA SGDKLEKKDL  120
GNLLAGIESS PGMETSEVLK LQMEVQKRLH EQLEVQRQLQ LRIEAQGKYL QKIMEEQQRL  180
SGVLCESGKM NALALAEEEL HHDFSKTEPS TPVLTSEPPF RDNAVTASGD LEGTDELLKV  240
LSSHDDCLSL DREFSTPDSS CGAGCLLNSP RDSKRARFSN SLGHGNSEFA LPRIIPESSS  300
GSDLQLSSVF SSGTGRSGSS AALDAIEDGF TNGLGSDV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A7e-2347104158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-2347104158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-2347104158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-2347104158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP3304850.0KP330485.1 Triticum aestivum MYB transcription factor SM154 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020148390.10.0myb family transcription factor PHL7-like
RefseqXP_020148391.10.0myb family transcription factor PHL7-like
SwissprotQ9SJW02e-81PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA0A0P0C1G80.0A0A0P0C1G8_WHEAT; MYB transcription factor SM154
TrEMBLA0A453SGM00.0A0A453SGM0_AEGTS; Uncharacterized protein
TrEMBLN1QSI50.0N1QSI5_AEGTA; Myb family transcription factor APL
STRINGEMT010450.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22203896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.14e-66G2-like family protein