PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011401513.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Auxenochlorella
Family bZIP
Protein Properties Length: 455aa    MW: 47348.6 Da    PI: 6.3587
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011401513.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.94.5e-08112161554
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                     k +   +kNR A+rr+R+R k++++eLee v++L+ + ++   e   l  
  XP_011401513.1 112 KQTALQEKNRRAQRRFRERQKMKVAELEEQVATLTLQLDRVTGERAALAS 161
                     5666789***************************8665554444444444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0058107172IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-6114168No hitNo description
SuperFamilySSF579592.01E-6117167No hitNo description
PfamPF077161.6E-4118151IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    Send to blast
MNQDFVEGGA PPPLAPDPLE LTGMAWDLDV EAFLDDYLKD VDAGPPDPFG TYPASLPIPT  60
QEPGVKSEAD PSSSEGLSDR LAKQTLDPQS GADCRGTPSP PPRAGKAQGV RKQTALQEKN  120
RRAQRRFRER QKMKVAELEE QVATLTLQLD RVTGERAALA SHASRLEAAL AAATAREEAA  180
AGDLRLTLRE GQSQSLTAEE LRGMTPAELA RYYKAYVNEL AQSLRASLAG LRALFQGKLA  240
GIRARRRGVV EALARAEPVG TGTRPLAALY LASHEAARGL REALREEHIL VLDFESTVFK  300
HVLSGLQVAQ LMIHSFPWTP DCLALCTWVA AEAGDADALG ALAAEAQRKA AAAAPHPGGG  360
VGPAGPFASP FLADSGVNAG ALAAQQHALA PLALAPRSAS GLSLPSPPHS MPGPGSSGTQ  420
HNGLCGPGMP FVSIGFGGMG SGGPAPGMLP VHTAS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011401513.10.0hypothetical protein F751_5721
TrEMBLA0A087SRZ00.0A0A087SRZ0_AUXPR; Uncharacterized protein
STRINGA0A087SRZ00.0(Auxenochlorella protothecoides)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP386744