PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011399624.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Auxenochlorella
Family bZIP
Protein Properties Length: 490aa    MW: 50866.3 Da    PI: 4.7086
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011399624.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.41.3e-12160219160
                     XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                     e e kr++r+++NRe A  sRqRKka++e Le+ + +L+++ +aL   + +l+ e + l+
  XP_011399624.1 160 EDEAKRAIRMARNRENAHLSRQRKKAQLEGLEQTCSALTGQVRALSTFVGQLTAENELLR 219
                     6789*******************************************9999999988665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.2E-13158223No hitNo description
SMARTSM003383.4E-11160224IPR004827Basic-leucine zipper domain
PfamPF001706.9E-11160220IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.082162225IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.25E-9164222No hitNo description
CDDcd147041.21E-13165215No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MSTLVQPLFE PEDVWPGVLM DDDVLESFQA SRLHLVVLED VRASPSASAV QFPLTHQALD  60
DLDQFEINRP PSPGQVLELL SDGVGTSPWG LDAGAVADPG KPDEAFGELI PMARPIHTPT  120
RSADGSAHHQ TSSGEDASNT SRYQQSSPAS QQDGAAGADE DEAKRAIRMA RNRENAHLSR  180
QRKKAQLEGL EQTCSALTGQ VRALSTFVGQ LTAENELLRR HLAAACTAAG RPLPDLPRGA  240
ARLAQNSGAG AGALRHAGRA LQMMPGRALQ MMPGRAAAAA EAGPGPELMG ALADLAPLAL  300
SLEGGGLGPL DPQSALPSLA EPVFKAWGMP PPGICRKLHS IEAGSLPLPL DVSRGDLVEF  360
LEGRLGAQGR ALSAVAPPLP RPLALLPGEG PEAPRDYPGA AESVGADPSQ CPPSPTRDVE  420
EESENVVRHD WMSVAEPVLL TALSAPAANA SNGAGAAAAP GVVVVMLEPG RRLVTYACDD  480
AVPRVAARAA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011399624.10.0TGACG-sequence-specific DNA-binding protein TGA-1B
TrEMBLA0A087SLT20.0A0A087SLT2_AUXPR; TGACG-sequence-specific DNA-binding protein TGA-1B
STRINGA0A087SLT20.0(Auxenochlorella protothecoides)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP539288
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56660.13e-10basic region/leucine zipper motif protein 49