PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011397660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Auxenochlorella
Family bZIP
Protein Properties Length: 243aa    MW: 26359.9 Da    PI: 4.7752
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011397660.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.41.1e-11161208350
                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                     + ++er kq+ Re+A rsR R+k +++ Lee+ ++L aeN aL+ +l+
  XP_011397660.1 161 AAQVERTKQRRRESAHRSRSRRKDYMKTLEEENDALRAENAALRAKLK 208
                     57899***************************************7775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001705.3E-8161208IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.036161208IPR004827Basic-leucine zipper domain
SMARTSM003380.0092162227IPR004827Basic-leucine zipper domain
CDDcd146864.69E-10165208No hitNo description
Gene3DG3DSA:1.20.5.1704.8E-9165208No hitNo description
SuperFamilySSF579595.69E-7165209No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MCRVILRPQA REQRGVAPSA VAGNFADLLT GFDPASLLEA KQEPLSPDSE LLETAEGFEL  60
QDTDADLLAM FQELAEEPAP ELAPLAMPTS PAASLPGPMV PFEPVQTLPV PARPAMTIFD  120
QQLMFQQAML QQQQAAMATA QIPVKPGYPT LRRGKTPEEV AAQVERTKQR RRESAHRSRS  180
RRKDYMKTLE EENDALRAEN AALRAKLKVQ GVSLTSSVMD AASRQTSGGA DSGSSSEVAA  240
MQM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011397660.11e-173hypothetical protein F751_3784
TrEMBLA0A087SGB81e-172A0A087SGB8_AUXPR; Uncharacterized protein
STRINGA0A087SGB81e-173(Auxenochlorella protothecoides)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP690344