PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011397290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Auxenochlorella
Family bZIP
Protein Properties Length: 516aa    MW: 54978.5 Da    PI: 6.0329
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011397290.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.36.9e-081331811159
                     HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1  11 qkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                     +kNR A++r+R+R ka+++  +e+ + +++e  +L+ e+  lk+  + l
  XP_011397290.1 133 EKNRRAQKRFRERQKAKMKDMTEELDDMTSELGRLRVENGALKNRNSIL 181
                     79*****************************************987655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0018123187IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.11E-7132183No hitNo description
Gene3DG3DSA:1.20.5.1707.6E-7132185No hitNo description
CDDcd146864.63E-11132179No hitNo description
PfamPF077162.0E-5133176IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 516 aa     Download sequence    Send to blast
MDMQGLDFGG GLPVVTGREN SLAELDALDV DNLMNFFGPM TTPIPSFGDG AMFLQQQMLQ  60
QQLPPRTPTG SAPLFPDPPL AAPAANLFSS IPMPDFGKPA TSSRPPADSD HSSDDAEGRS  120
RGPDAHKTTA IQEKNRRAQK RFRERQKAKM KDMTEELDDM TSELGRLRVE NGALKNRNSI  180
LEKVLALRDE HIRVLQDEQH VFDLGNHHLQ TSNPKLLGPG PAAPAMLGYG AGGGGSGLQG  240
GGLPGSGQGA GSQLPARGSG PLALSAALAS EVASVKTMPA DAVISRWKET VRELGNILVT  300
LEGCPDPSAP AHAEASATLT RVLDAAGALC MHTAVLHPTN MQRLIATALD DGRSGISSED  360
RARWAGVTAS LALAPDQRAQ VVSLRAIFLR RMRRVVEERR AILDRLQSVS VPDRMLALQS  420
VIAETLKVNE CTVELKANLQ EEHLAGMEFI GTVFKTIFTP LQKARAIVQS YPFYPDVYQI  480
ATALVSEQEA GLDGVGAGPG AEAGALINIP VAYKAY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011397290.10.0hypothetical protein F751_3120
TrEMBLA0A087SF980.0A0A087SF98_AUXPR; Uncharacterized protein
STRINGA0A087SF980.0(Auxenochlorella protothecoides)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP190466