PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 914964
Common NameARALYDRAFT_914964
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 63aa    MW: 7054.17 Da    PI: 9.326
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
914964genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26030.97.5e-103495399
  DUF260 53 eredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99
            e+++ + s  +eA++r+  P+yG+vg+i+ lq+q++++k+e  l+k+
  914964  3 EQQQWVISSSFEAQCRIVGPIYGCVGIISLLQSQIQTKKNENLLAKT 49
            4666777889*****************************99887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031951.8E-7345IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 63 aa     Download sequence    Send to blast
MKEQQQWVIS SSFEAQCRIV GPIYGCVGII SLLQSQIQTK KNENLLAKTN LVRTTLPNSY  60
FH*
Cis-element ? help Back to Top
SourceLink
PlantRegMap914964
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLD7MBX84e-38D7MBX8_ARALL; Uncharacterized protein
STRINGscaffold_702706.16e-39(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26620.14e-12LOB domain-containing protein 23