PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 905051
Common NameARALYDRAFT_905051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 120aa    MW: 13972.3 Da    PI: 10.999
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
905051genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26043.11.2e-1338102267
  DUF260   2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAea 67 
             C  C++++++ ++dC++a  fp+++ +kf +++ +FG ++++ +lk+l++ +r+ ++++l++e+ +
  905051  38 CRFCRLQNKQ-VNDCIFASLFPSNDLRKFTIMNLVFGPETLTFFLKDLSHMDRKYTTRTLYFEGSV 102
             999****996.789*************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089110.09936119IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-1138102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 120 aa     Download sequence    Send to blast
MHSPHLSSIL QVAKIISNII SFIVFSRERQ IKMNPNLCRF CRLQNKQVND CIFASLFPSN  60
DLRKFTIMNL VFGPETLTFF LKDLSHMDRK YTTRTLYFEG SVSRSMGERS LRKNSKFRS*
Cis-element ? help Back to Top
SourceLink
PlantRegMap905051
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001326100.11e-23LOB domain-containing protein 26
RefseqNP_001326101.11e-23LOB domain-containing protein 26
RefseqNP_189433.11e-23LOB domain-containing protein 26
SwissprotQ9LIJ01e-24LBD26_ARATH; LOB domain-containing protein 26
TrEMBLD7LPM51e-81D7LPM5_ARALL; Uncharacterized protein
STRINGscaffold_500755.12e-82(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2101245
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27940.15e-27LOB domain-containing protein 26