PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 904858
Common NameARALYDRAFT_904858
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 122aa    MW: 13696.8 Da    PI: 8.5805
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
904858genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.32e-4151051101
  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
             +CaaCk+lrr+C+kdC+++pyfp ++p+kfa++h+++Ga nv+k+l++lp+++r +a++sl++eA++r++dPvyG+vg+i+ lq q++q++++la++++e+
  904858   5 RCAACKYLRRRCPKDCIFSPYFPPNDPAKFACIHRIYGAGNVSKMLQQLPDQTRAEAVESLCFEAKCRVDDPVYGCVGIIHLLQTQIQQTQNQLAKTQAEI 105
             6***********************************************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.2924105IPR004883Lateral organ boundaries, LOB
PfamPF031958.3E-415102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MNPKRCAACK YLRRRCPKDC IFSPYFPPND PAKFACIHRI YGAGNVSKML QQLPDQTRAE  60
AVESLCFEAK CRVDDPVYGC VGIIHLLQTQ IQQTQNQLAK TQAEIAVAQT KFSQTHNSDF  120
M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-37610512111LOB family transfactor Ramosa2.1
5ly0_B2e-37610512111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap904858
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738471e-161AB473847.1 Arabidopsis thaliana ASL14 mRNA for ASYMMETRIC LEAVES2-like 14 protein, complete cds.
GenBankDQ0566091e-161DQ056609.1 Arabidopsis thaliana putative LOB domain protein (At3g26620) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002875328.15e-87LOB domain-containing protein 24
SwissprotP594681e-83LBD24_ARATH; LOB domain-containing protein 24
TrEMBLD7LR741e-85D7LR74_ARALL; Uncharacterized protein
STRINGscaffold_500562.12e-86(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.15e-70LOB domain-containing protein 24