PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 900851
Common NameARALYDRAFT_900851
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 312aa    MW: 34834.2 Da    PI: 4.3847
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
900851genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.83.9e-4351041100
  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
             +CaaCk+lrrkC+++Cv+apyfp ++p+kf +vh++FGasnv+k+l++lp+++red+++sl+yeAear+rdP+yG+vg+i+ lqq l++ +++l+++kee
  900851   5 PCAACKLLRRKCTQECVFAPYFPPTNPQKFIFVHRVFGASNVTKILNDLPPDQREDTVNSLFYEAEARIRDPIYGCVGLISFLQQYLKKIQQDLVTAKEE 104
             7**********************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381551.9E-1192309IPR017414LOB domain-containing protein 10/36/41
PROSITE profilePS5089127.2484105IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-415102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MASTPCAACK LLRRKCTQEC VFAPYFPPTN PQKFIFVHRV FGASNVTKIL NDLPPDQRED  60
TVNSLFYEAE ARIRDPIYGC VGLISFLQQY LKKIQQDLVT AKEELAGYMG PDAVIPPPYL  120
PALGNNPPPN FMMSMEGMPP GVIPQGEPLM IREPNLSQQH HQHQPQDEQL QFIASDAQRM  180
AAMMLDRGDQ QGMFNGYGID NNGSVTATGF NQMDVNDHGA SGWLSGPSLA LGSFGDAFQM  240
GQETEHGHIN HDQLQTQLML QPPLQEGQEQ TEEGQFLMQP MGQENLHEEE EEEELEPPIK  300
WRKSESKEAS Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-4621088114LOB family transfactor Ramosa2.1
5ly0_B3e-4621088114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap900851
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738350.0AB473835.1 Arabidopsis thaliana ASL2 mRNA for ASYMMETRIC LEAVES2-like 2 protein, complete cds.
GenBankAC0030400.0AC003040.3 Arabidopsis thaliana chromosome 2 clone F26B6 map CIC06C07, complete sequence.
GenBankAC0044820.0AC004482.3 Arabidopsis thaliana chromosome 2 clone F27L4 map CIC06C07, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002880519.10.0LOB domain-containing protein 10
RefseqXP_020883060.10.0LOB domain-containing protein 10
SwissprotO648360.0LBD10_ARATH; LOB domain-containing protein 10
TrEMBLD7LG100.0D7LG10_ARALL; LOB domain family protein
STRINGscaffold_400352.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM149081720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23660.21e-172LOB domain-containing protein 10
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]