PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 898758
Common NameARALYDRAFT_898758
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CPP
Protein Properties Length: 624aa    MW: 67956.5 Da    PI: 8.141
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
898758genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.73.7e-16337375240
     TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
             ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  898758 337 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 375
             689**********************************96 PP

2TCR51.22.4e-16422460139
     TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
             ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  898758 422 RHKRGCNCKKSNCLKKYCECYQGGVGCSINCRCEGCKNA 460
             589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.4E-19336377IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.394337462IPR005172CRC domain
PfamPF036385.9E-12339374IPR005172CRC domain
SMARTSM011143.7E-17422463IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.6E-12424460IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 624 aa     Download sequence    Send to blast
MDTPQKSVTQ IGTPVSKLKV EDSPVFNYIC SLSPIKTLKS IPITQTLSSL NFTSPPSVFT  60
SPHAVSHKES RFRSQKDGSA SKEVASIGEE GNEEALVENS EPAQSHKNDC NTPRVSNDVR  120
GNGCCEDSGK DLQKMMDNVK KKSDTPDWET LISATTELIY GSPRESEAFS CLLKKTSNSE  180
ARLRGGTMPT SKPVSNTNVG NNESESVDAL SILHRGVRRR CLDFEIPGNN QQTVGESSSS  240
CVVPSIGLHL NAVAMPSKDN NVANEYSFSV NMKVGLQSST TPLLQSQHDS VRENETGKDA  300
SKVIEVVPKS SGLVELTPIS PKKKRRKSEQ SGEGGSSCKR CNCKKSKCLK LYCECFAAGV  360
YCIEPCSCID CFNKPIHEDV VLATRKQIES RNPLAFAPKV IRNSDSIIEV GEDASKTPAS  420
ARHKRGCNCK KSNCLKKYCE CYQGGVGCSI NCRCEGCKNA FGRKDGSLFE QDEENETSGK  480
SGTMKKQQNV ELFIPAAQPS TPMPIRQPLA QLPLSSNNRL LPPQSHFHHG AIGSSSSGIY  540
NIRKPDMSLL SHSRIETITE DIDDDMSENL IHSPIANINS LSPNSKRVSL AHLDSSESSP  600
WRRTGGRNLI RSFPTFPSLT PHH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A7e-1733945912120Protein lin-54 homolog
5fd3_B7e-1733945912120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1321325KKKRR
2321326KKKRRK
3322326KKRRK
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00044PBMTransfer from AT3G22760Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap898758
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0996530.0AY099653.1 Arabidopsis thaliana unknown protein (At3g22760) mRNA, complete cds.
GenBankAY1288370.0AY128837.1 Arabidopsis thaliana unknown protein (At3g22760) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002883376.10.0protein tesmin/TSO1-like CXC 3
SwissprotQ8L5480.0TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
TrEMBLD7L2F20.0D7L2F2_ARALL; Uncharacterized protein
STRINGscaffold_302728.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]