PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 895772
Common NameARALYDRAFT_895772
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family BES1
Protein Properties Length: 325aa    MW: 34564.3 Da    PI: 7.3048
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
895772genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822213.45.8e-6621451149
  DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl.eeaeaagssasaspesslqsslkssa 102
             ++++r+ptw+ErEnnkrRERrRRaiaaki++GLR++Gny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg++++ e++e++g sa+asp+ss+q       
  895772   2 TSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAGWIVEPDGTTYRKGCSRPvERMEVGGGSATASPCSSYQ------- 97 
             5899**********************************************************************999*******************....... PP

  DUF822 103 laspvesysaspksssfpspssldsislasa..asllpvlsvlslvsss 149
              +sp++sy++sp  s+f+sp+s+++++l+s   +sl+p+l++ls++sss
  895772  98 -PSPCASYNPSPGPSNFMSPASSSFANLTSGdgQSLIPWLKHLSTTSSS 145
             .*********************99999998788**********997776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056874.0E-633140IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MTSGTRMPTW RERENNKRRE RRRRAIAAKI FTGLRMYGNY ELPKHCDNNE VLKALCNEAG  60
WIVEPDGTTY RKGCSRPVER MEVGGGSATA SPCSSYQPSP CASYNPSPGP SNFMSPASSS  120
FANLTSGDGQ SLIPWLKHLS TTSSSSASSS SRLPNYLYIP GGSISAPVTP PLSSPTARTP  180
RMNADWQQLN NSFFVSSTPP SPTRQIPDSE WFSGIQLAQS VPASPTFSLV SQNPFGFKEE  240
AASAAGGGGG SRMWTPGQSG TCSPAIPPAA DQTADVPMSE AVAPPEFAFG SNTNGLVKAW  300
EGERIHEESG SDDLELTLGN SSTR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0903310.0AY090331.1 Arabidopsis thaliana At1g78700/F9K20_26 mRNA, complete cds.
GenBankAY0504300.0AY050430.1 Arabidopsis thaliana At1g78700/F9K20_26 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002887754.10.0hypothetical protein ARALYDRAFT_895772
SwissprotQ9ZV880.0BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLD7KVU20.0D7KVU2_ARALL; Putative uncharacterized protein
STRINGscaffold_202846.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.10.0BES1/BZR1 homolog 4