PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 892643
Common NameARALYDRAFT_892643
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GeBP
Protein Properties Length: 306aa    MW: 35137.8 Da    PI: 9.1966
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
892643genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573123.88.2e-39125218297
  DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
             +fqr wse+DeivlLqG+idfk+++gksp+dd++af+++vk+ isf++++sq+++KirrLK+K+ +k++k    +e+sf+k+hd k+f+lsk iW+
  892643 125 YFQRKWSEDDEIVLLQGMIDFKNDKGKSPYDDMTAFIDTVKNIISFQANQSQFTTKIRRLKDKYLRKRNK--GADEKSFAKAHDLKCFQLSKLIWE 218
             8********************************************************************9..889999*****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045043.9E-30126218IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MRGITKLLAS RSLKSSMAKK KKRSQPENKL SELENKRLKP EEDPSTVKRC LQLLEDPPTK  60
KRSPQSLENP PTTESSGDDE EMATEEEGHE SGSSSEEEGK ESGSSSEEEE QKDPGKNFPP  120
TKKNYFQRKW SEDDEIVLLQ GMIDFKNDKG KSPYDDMTAF IDTVKNIISF QANQSQFTTK  180
IRRLKDKYLR KRNKGADEKS FAKAHDLKCF QLSKLIWEST KVKEESLKPN EEKVLDWFVN  240
SSLVGSVASF GVAEHVVKQR WSLVSMKMKK KLEEKFKLLK EKESEYLWLK SRFFHEVNSL  300
IAEAN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14549TVKRC
2185191DKYLRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0062001e-85AC006200.3 Arabidopsis thaliana chromosome 2 clone F10A8 map rga, complete sequence.
GenBankCP0026851e-85CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
GenBankAY6492471e-85AY649247.1 Arabidopsis thaliana hypothetical protein (At2g01370) gene, complete cds.
GenBankAY5013591e-85AY501359.1 Arabidopsis thaliana hypothetical protein (At2g01370) mRNA, complete cds.
GenBankAB4935431e-85AB493543.1 Arabidopsis thaliana At2g01370 gene for hypothetical protein, partial cds, clone: RAAt2g01370.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002891875.10.0hypothetical protein ARALYDRAFT_892643
TrEMBLD7KNW40.0D7KNW4_ARALL; Putative uncharacterized protein
STRINGscaffold_105437.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01370.14e-83DNA-binding storekeeper protein-related transcriptional regulator