PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 888711
Common NameARALYDRAFT_888711
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Trihelix
Protein Properties Length: 413aa    MW: 47287.7 Da    PI: 7.3655
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
888711genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix86.43.3e-2788169286
  trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
               W ++e++ Li +rr m+  ++++k++k+lWe++s+kmre+gf rsp++C++kw+nl k++kk k++++++    s +++y++++e
    888711  88 WVQDETRSLIMFRRGMDGLFNTSKSNKHLWEQISAKMREKGFDRSPTMCTDKWRNLLKEFKKAKHHDRGN---GSAKMSYYKEIE 169
               ********************************************************************94...566899***998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.0E-478149IPR009057Homeodomain-like
PROSITE profilePS500907.97980144IPR017877Myb-like domain
SMARTSM007170.009684146IPR001005SANT/Myb domain
CDDcd122032.30E-2986151No hitNo description
PfamPF138371.3E-2087170No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MFISDKSRPS TDFYKDDNPN SSTTTTRDMM IDVTTTNESV DLQSHHHHNH NHHNRHLHQP  60
QPQQQILLGE SSGEDHEVKA PKKRAETWVQ DETRSLIMFR RGMDGLFNTS KSNKHLWEQI  120
SAKMREKGFD RSPTMCTDKW RNLLKEFKKA KHHDRGNGSA KMSYYKEIED ILRERNKKVT  180
PQYNKSPNTP PTSAKVDSFM QFTDKGFDDT SISFGSVEAN GRPALNLERR LDHDGHPLAI  240
TTVDAVAANG VTPWNWRETP GNGGDSHGQA FGGRVITVKF GDYTRRIGVD GSAEAIKEAI  300
RSAFGLRTRR AFWLEDEDQI IRCLDRDMPL GNYLLHLDNV CKTHLAGLAI RVCHYDESNQ  360
LPVHSEEKIF YTEEDYRDFL ARRGWTCLQV DGFRNIENMD DLQPGAVYRG VR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A6e-5682167186DNA binding protein GT-1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00004PBM25215497Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2283050.0AK228305.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-74-C23.
GenBankATHGT0.0L36806.1 Arabidopsis thaliana (clone pDGT1) GT-1 mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002892750.10.0DNA binding protein GT-1
SwissprotQ9FX530.0TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLD7KQG00.0D7KQG0_ARALL; DNA binding protein GT-1
STRINGscaffold_101505.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28912768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.10.0Trihelix family protein