PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 888456
Common NameARALYDRAFT_888456
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GeBP
Protein Properties Length: 170aa    MW: 19139.2 Da    PI: 10.3928
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
888456genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57345.61.9e-141435597
  DUF573 55 veKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97
            +eK+r+LKkK++++  kak+g+ep f k+hd+k+felsk +Wg
  888456  1 MEKLRSLKKKYENNLGKAKEGDEPIFVKPHDRKAFELSKLVWG 43
            79****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.2E-11143IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MEKLRSLKKK YENNLGKAKE GDEPIFVKPH DRKAFELSKL VWGGIRMVLQ SGMKSNGKSK  60
KSSKSKKVES VKHEFDCEDD VTNKGEASLV GALEMDTLVK SSLARSIARF GLDQLVAQQG  120
LSLLSSEDKK RFEVQWKALQ LREFEFLSQK SCFLHKVVKK MTEVSRSNA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0116618e-70AC011661.5 Genomic sequence for Arabidopsis thaliana BAC T23J18 from chromosome I, complete sequence.
GenBankCP0026848e-70CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankAB4934498e-70AB493449.1 Arabidopsis thaliana At1g11510 gene for hypothetical protein, partial cds, clone: RAAt1g11510.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002892648.11e-119hypothetical protein ARALYDRAFT_888456
TrEMBLD7KMF51e-119D7KMF5_ARALL; Putative uncharacterized protein
STRINGscaffold_101250.11e-118(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G11510.13e-53DNA-binding storekeeper protein-related transcriptional regulator