PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 887830
Common NameARALYDRAFT_887830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 206aa    MW: 23319.1 Da    PI: 10.0199
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
887830genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260110.31.4e-3424115192
  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
             aCa+Ck++r+kC+++C+l+pyfpa+++k+f++vhk+FG+snv+k++++++ee+r+++ +sl++eA +r++dPv G++g ++++ ++l+  k+
  887830  24 ACASCKHQRKKCNNECILSPYFPARKTKEFQAVHKVFGVSNVQKMVRTVREEDRTKLSDSLTWEALWRQKDPVLGSYGEYRRICEELKLYKS 115
             7***********************************************************************************99998775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.1723123IPR004883Lateral organ boundaries, LOB
PfamPF031958.4E-3224114IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MMQRNSNNTT TTTNISNNSS SHQACASCKH QRKKCNNECI LSPYFPARKT KEFQAVHKVF  60
GVSNVQKMVR TVREEDRTKL SDSLTWEALW RQKDPVLGSY GEYRRICEEL KLYKSLVHNQ  120
PLIGNWDNNQ RVFSNNSNNK NGLAMNSSGS GGLSVNNNGV GVNREIVNVG YTSRNVQGGW  180
ENLKQDQRQQ CYAVINGFKQ HYVPL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-18251011288LOB family transfactor Ramosa2.1
5ly0_B6e-18251011288LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap887830
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738650.0AB473865.1 Arabidopsis thaliana ASL32 mRNA for ASYMMETRIC LEAVES2-like 32 protein, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankF9P140.0AC025290.3 Sequence of BAC F9P14 from Arabidopsis thaliana chromosome 1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002892332.11e-152LOB domain-containing protein 2
RefseqXP_020869821.11e-152LOB domain-containing protein 2
SwissprotQ9LNB91e-123LBD2_ARATH; LOB domain-containing protein 2
TrEMBLD7KG181e-151D7KG18_ARALL; Uncharacterized protein
STRINGscaffold_100624.11e-152(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM105392635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.12e-92LOB domain-containing protein 2