PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 885142
Common NameARALYDRAFT_684586
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 94aa    MW: 10848.7 Da    PI: 8.9205
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
885142genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26086.34.1e-271294486
  DUF260  4 aCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86
            +C + +++C+++C +a+yfp + + +++ +++lFG+ n++k+++++pee+++++++s+++e++a+++dP++G +gv++k+ ++
  885142 12 VCITRNKNCPQNCEYAKYFPYKLQCQYESANELFGTPNIIKMMRHAPEEKKQILATSIIMEGNAWTKDPISGGFGVMQKIMWK 94
            8******************************************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089119.533894IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-211293IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    Send to blast
MEPLGNPRPY SVCITRNKNC PQNCEYAKYF PYKLQCQYES ANELFGTPNI IKMMRHAPEE  60
KKQILATSII MEGNAWTKDP ISGGFGVMQK IMWK
Cis-element ? help Back to Top
SourceLink
PlantRegMap885142
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738661e-91AB473866.1 Arabidopsis thaliana ASL33 mRNA for ASYMMETRIC LEAVES2-like 33 protein, complete cds.
GenBankDQ0564801e-91DQ056480.1 Arabidopsis thaliana LOB domain family protein (At1g36000) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002865796.24e-66LOB domain-containing protein 5
SwissprotQ9C8V81e-55LBD5_ARATH; LOB domain-containing protein 5
TrEMBLD7MQ681e-64D7MQ68_ARALL; Predicted protein (Fragment)
STRINGAl_scaffold_0008_14062e-65(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122821432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G36000.16e-58LOB domain-containing protein 5