PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 878939
Common NameARALYDRAFT_678383
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 329aa    MW: 35353.9 Da    PI: 9.7172
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
878939genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.11.9e-3871128461
  zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
               lkcprCds+ntkfCyynny+l+qPr+fCk+CrryWt+GGalrnvPvGgg+r+n+k+
  878939  71 GPLKCPRCDSSNTKFCYYNNYNLTQPRHFCKGCRRYWTQGGALRNVPVGGGCRRNNKK 128
             5789**************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-3456124IPR003851Zinc finger, Dof-type
PfamPF027012.9E-3272127IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.62773127IPR003851Zinc finger, Dof-type
PROSITE patternPS01361075111IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009625Biological Processresponse to insect
GO:0009753Biological Processresponse to jasmonic acid
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MPTNSNHQHH HQHQLLENGS IISGHGLLSH QLPPLQANPN PSHQYVATSA GLPSRSMAER  60
ARQAKIPPPE GPLKCPRCDS SNTKFCYYNN YNLTQPRHFC KGCRRYWTQG GALRNVPVGG  120
GCRRNNKKGK NGNSKSSSSS SKQSSSSANA PSPSSGQLRT NHQFPFSPTL YNLTQLGGIG  180
LNLAATNSNN QSHQIGSSLM NDLGFLHVGN GRNTSTPMTG NIHENNNNNE NNLMASVGSL  240
SHFALFDPTT GLYAFQNEGN IGNNVGISGS STSMVDSRVY QTPPVKMEEQ PNLANLSRPV  300
SGLTSPGNQT NQYFWPGSDF SGPSNDLL*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements (By similarity). Involved in the regulation of root development (PubMed:23057675). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Element of a regulatory network controlling indole glucosinolates (IGS) biosynthesis, probably by inducing the expression of accurate genes (e.g. CYP83B1). Promotes apical dominance (PubMed:16740150). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:16740150, ECO:0000269|PubMed:23057675, ECO:0000269|PubMed:30626969}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap878939
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and salicylic acid (SA) (PubMed:10758484). Induced transiently in response to the generalist herbivore S.littoralis. Triggered by methyl jasmonate (MeJA) and wounding (PubMed:16740150). {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:16740150}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0627150.0AY062715.1 Arabidopsis thaliana Strong similarity to zinc finger protein OBP2 (At1g07640; F24B9.30) mRNA, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankF24B90.0AC007583.2 Arabidopsis thaliana chromosome 1 BAC F24B9 sequence, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002892410.10.0dof zinc finger protein DOF1.1 isoform X3
SwissprotQ8L9V60.0DOF11_ARATH; Dof zinc finger protein DOF1.1
TrEMBLD7KH400.0D7KH40_ARALL; Predicted protein
STRINGAl_scaffold_0001_7060.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53361749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.21e-162Dof family protein
Publications ? help Back to Top
  1. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]