PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 874847
Common NameARALYDRAFT_674291
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CPP
Protein Properties Length: 569aa    MW: 61024.5 Da    PI: 8.0936
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
874847genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.41.6e-14114154142
     TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
             ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ e+
  874847 114 QKKKQCNCKHSRCLKLYCECFASGSYCDG-CNCVNCHNNVEN 154
             589**************************.********9875 PP

2TCR51.61.9e-16199238140
     TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
             +++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  874847 199 RHNKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNFE 238
             589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.7E-16114154IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.3115239IPR005172CRC domain
PfamPF036383.3E-11116151IPR005172CRC domain
SMARTSM011141.0E-19199240IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-12202237IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 569 aa     Download sequence    Send to blast
MGEGEEGEKF PPKTDEVTLE SMKSARQLDF TGVEYSQSNQ PPVASSSTAA ASIPSPVTRP  60
ITSQARPVTA TVGTPIPPPP QSQGILHVPI RHPVDTCFFS FVRPVGEARD GTPQKKKQCN  120
CKHSRCLKLY CECFASGSYC DGCNCVNCHN NVENEPERRE AIGSTLERNP NAFRPKIAAS  180
PHGGRDNREE VGEVVLLGRH NKGCHCKKSG CLKKYCECFQ ANILCSENCK CLDCKNFEGS  240
EVRQSLFHGE HSHNVAYLQH ANAAITGAIG SSGFASAPAP KRRKGQEIFF NQGPKDSSTH  300
RLGQANSGRT TSPKTGSHAG GNASLRPSKV VYRSLLADII KPKDVKALCS VLVSVAGEAA  360
KTLTEERLAD QKETSVASSV QDQGHSNNKG TEGEKAASGN QAEKSGPDGS KGRSLSPETL  420
ALMCDERDTM LMVAASPNCS VEPPSQLPNG QDQVYAEQEK VVLTKFRDCL NRIISCGEVK  480
ESNCLMSRMD LDTPVHTAVK IDPVVDQRPV ANGVSQTAKQ PSQLTTTTKT TTTTTTITTT  540
TTTTTTTPNT SSQTHLHKTP ALSEKKDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-321062481132Protein lin-54 homolog
5fd3_B1e-321062481132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00269DAPTransfer from AT2G20110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap874847
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935560.0AB493556.1 Arabidopsis thaliana At2g20110 mRNA for hypothetical protein, partial cds, clone: RAAt2g20110.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020887986.10.0protein tesmin/TSO1-like CXC 6
RefseqXP_020887987.10.0protein tesmin/TSO1-like CXC 6
SwissprotQ9SL700.0TCX6_ARATH; Protein tesmin/TSO1-like CXC 6
TrEMBLD7L5B70.0D7L5B7_ARALL; Predicted protein
STRINGAl_scaffold_0003_34880.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20110.10.0Tesmin/TSO1-like CXC domain-containing protein