PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 866425
Common NameARALYDRAFT_665869
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 187aa    MW: 21296.2 Da    PI: 6.8604
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
866425genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.11.4e-38121111100
  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
             +CaaCk lrrkC+kdCv+apyfp ++++++++vhk+FGas+v  l+++l++ +re am+sl++eA++r++dPvyG++++i +l++ql+ ++++la++k+e
  866425  12 PCAACKQLRRKCTKDCVFAPYFPTTKQENYEAVHKVFGASHVATLINDLHPLKREFAMNSLAWEARVRVKDPVYGCTAIIDRLESQLKDSEEQLAMVKNE 111
             7***********************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.05811112IPR004883Lateral organ boundaries, LOB
PfamPF031953.6E-3712109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MLFHQMDKIS TPCAACKQLR RKCTKDCVFA PYFPTTKQEN YEAVHKVFGA SHVATLINDL  60
HPLKREFAMN SLAWEARVRV KDPVYGCTAI IDRLESQLKD SEEQLAMVKN ELASYGIVPT  120
CVPSPPMMYQ QMHNNPMTIS EYTPNNGGFL TGQQLHDEAQ RFVSTQRAQM QQTQETQTQH  180
NEIDRD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-34101239127LOB family transfactor Ramosa2.1
5ly0_B1e-34101239127LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap866425
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020882469.11e-141LOB domain-containing protein 28 isoform X1
SwissprotQ9SCS43e-97LBD28_ARATH; LOB domain-containing protein 28
TrEMBLD7LTF61e-140D7LTF6_ARALL; Predicted protein
STRINGAl_scaffold_0005_19041e-140(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50510.13e-92LOB domain-containing protein 28