PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 497425
Common NameARALYDRAFT_497425
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family VOZ
Protein Properties Length: 456aa    MW: 51179.9 Da    PI: 4.9566
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
497425genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ420.43e-1292244382216
     VOZ   2 ppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdlsllege 104
             ppsaflgpkcalwdctrpaqgsew+ dycs++h tlalne++pgt+pvlrp+gi+lkd+ll++al+ak+qgk+vgip+cega+++k+pwnaaelf+l+l+ege
  497425 224 PPSAFLGPKCALWDCTRPAQGSEWYLDYCSNYHGTLALNEDSPGTAPVLRPGGISLKDNLLIDALRAKTQGKNVGIPVCEGAVNTKCPWNAAELFHLELVEGE 326
             7****************************************************************************************************** PP

     VOZ 105 tirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksakgkvskdslad 207
             tirewlffdkprra++sgnrkqrslpdysgrgwhesrk  mke++g+krsyymdpqp++ fewhl+ey+ine+da+alyrlelk+ ++kks+kgk+skd+lad
  497425 327 TIREWLFFDKPRRAYDSGNRKQRSLPDYSGRGWHESRKVPMKEQEGQKRSYYMDPQPPGPFEWHLFEYQINESDACALYRLELKVGNGKKSPKGKISKDPLAD 429
             ******************************************************************************************************* PP

     VOZ 208 lqkklgrlt 216
             lqkk+g+++
  497425 430 LQKKMGQFK 438
             ******986 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MSNHPKITCV SSAHQNVEEK LRELQERFCH LQAARKEGRH GDLALLEAQI SQNIREWQAE  60
LTAPSPESSL LGEGISQFLE EFAPLLKLDE EDDATSTLKE HSAQKPDPEG FAQSLCPPEW  120
TSENFSQSPF NGNFSCSFED ALNNTETRGQ QLHYGYEGFD PSINTAPDFH DQKLSSNLDI  180
TSQYDYILSE VRQELDNSPS IKLDSSEEID NFTEFTTPSS VRVPPSAFLG PKCALWDCTR  240
PAQGSEWYLD YCSNYHGTLA LNEDSPGTAP VLRPGGISLK DNLLIDALRA KTQGKNVGIP  300
VCEGAVNTKC PWNAAELFHL ELVEGETIRE WLFFDKPRRA YDSGNRKQRS LPDYSGRGWH  360
ESRKVPMKEQ EGQKRSYYMD PQPPGPFEWH LFEYQINESD ACALYRLELK VGNGKKSPKG  420
KISKDPLADL QKKMGQFKVA SDKPSPPTKG RKDLS*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ1 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Binds as a dimer to the palindromic sequence 5'-GCGTNNNNNNNACGC-3'. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00018PBMTransfer from AT2G42400Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap497425
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. Down-regulated by far-red light (at protein level). {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3618310.0AF361831.1 Arabidopsis thaliana At2g42400/MHK10.12 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020867124.10.0transcription factor VOZ2
RefseqXP_020867188.10.0transcription factor VOZ2
SwissprotQ9SLB90.0VOZ2_ARATH; Transcription factor VOZ2
TrEMBLD7MXH80.0D7MXH8_ARALL; Uncharacterized protein
STRINGfgenesh2_kg.409__2__AT2G42400.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM110602534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42400.10.0vascular plant one zinc finger protein 2
Publications ? help Back to Top
  1. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  2. Koguchi M,Yamasaki K,Hirano T,Sato MH
    Vascular plant one-zinc-finger protein 2 is localized both to the nucleus and stress granules under heat stress in Arabidopsis.
    Plant Signal Behav, 2017. 12(3): p. e1295907
    [PMID:28277968]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]