PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 496913
Common NameARALYDRAFT_496913
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 309aa    MW: 34128 Da    PI: 6.8312
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
496913genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.11.5e-4371061100
  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
             +CaaCk+lrrkC+++Cv+apyfp +qp+kfa+vhk+FGasnv kll++l  ++reda++sl+yeAear+rdPvyG+vg+i+ lq++l+ql+++l+ +k+e
  496913   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFAYVHKVFGASNVAKLLNELASNHREDAVNSLFYEAEARLRDPVYGCVGLISILQHRLKQLQQDLENAKKE 106
             7**********************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381554.3E-1134309IPR017414LOB domain-containing protein 10/36/41
PROSITE profilePS5089126.7386107IPR004883Lateral organ boundaries, LOB
PfamPF031955.5E-437104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MASSSSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFAYVH KVFGASNVAK LLNELASNHR  60
EDAVNSLFYE AEARLRDPVY GCVGLISILQ HRLKQLQQDL ENAKKELATY VGPQAMLPIL  120
QPPQPHFMSP PPQPQRPSSS SASVLTQHQH NLLPMMGIPT GQLYHQQQQQ IFEAQQLAAV  180
AREQQNEMFR AYGGGGSSSP HHQNQAQAEI LRFNNGFDSV PAGSVTVTGF NQLSSGGTAV  240
TGMSLGGNFV DSPSTNNNYH TDQQLHHHHQ QQQHHEAQLF IPTQSSQPLP LQTQETQTLT  300
QPNSESEEG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-4841108114LOB family transfactor Ramosa2.1
5ly0_B2e-4841108114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap496913
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0107000.0AB010700.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MUD21.
GenBankAB1643030.0AB164303.1 Arabidopsis thaliana ASL1 mRNA for ASYMMETRIC LEAVES2-like gene 1 protein, complete cds.
GenBankAB4738340.0AB473834.1 Arabidopsis thaliana ASL1 mRNA for ASYMMETRIC LEAVES2-like 1 protein, complete cds.
GenBankBT0440580.0BT044058.1 Arabidopsis thaliana unknown protein (At5g66870) mRNA, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020868027.10.0LOB domain-containing protein 36
SwissprotQ9FKZ31e-179LBD36_ARATH; LOB domain-containing protein 36
TrEMBLD7MLW90.0D7MLW9_ARALL; Uncharacterized protein (Fragment)
STRINGfgenesh2_kg.8__2729__AT5G66870.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80082441
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-155ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]