PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 492971
Common NameARALYDRAFT_492971
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family BES1
Protein Properties Length: 285aa    MW: 30886.6 Da    PI: 8.4041
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
492971genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822208.61.7e-6421351146
  DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslkssal 103
             ++++r+ptwkErEnnkrRERrRRaiaaki+aGLR +Gn+klpk++DnneVlkALc+eAGw+vedDGttyrkg++p++++e ++ s+sasp+ss+q        
  492971   2 TSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAGWTVEDDGTTYRKGCRPMDRMELMNGSTSASPCSSYQ-------- 96 
             5899*******************************************************************************************........ PP

  DUF822 104 aspvesysaspksssfpspssldsislasaasllpvlsvlslv 146
             +sp++sy++sp+ss+fpsp++    +  +a+sl+p+l++ls+ 
  492971  97 HSPRASYNPSPSSSTFPSPTN----PFGDANSLIPWLKNLSSN 135
             *******************98....56677899****999763 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.5E-593132IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MTSGTRTPTW KERENNKRRE RRRRAIAAKI FAGLRIHGNF KLPKHCDNNE VLKALCNEAG  60
WTVEDDGTTY RKGCRPMDRM ELMNGSTSAS PCSSYQHSPR ASYNPSPSSS TFPSPTNPFG  120
DANSLIPWLK NLSSNSPSKL PFFHGNSISA PVTPPLARSP TRDQVTIPDS GWLSGMQTPQ  180
SGPSSPTFSL VSRNPFFDKE AFKMGDCNSP MWTPGQSGNC SPAIPAGVDQ NSDVPMADGM  240
AAEFAFGCNA IAAIGMVKPW EGERIHGECV SDDLELTLGN SRTK*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00444DAPTransfer from AT4G18890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0245120.0BT024512.1 Arabidopsis thaliana At4g18890 mRNA, complete cds.
GenBankAY0883790.0AY088379.1 Arabidopsis thaliana clone 6321 mRNA, complete sequence.
GenBankAK1188500.0AK118850.1 Arabidopsis thaliana At4g18890 mRNA for unknown protein, complete cds, clone: RAFL21-18-A16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002870016.10.0hypothetical protein ARALYDRAFT_492971
SwissprotO494040.0BEH3_ARATH; BES1/BZR1 homolog protein 3
TrEMBLD7M9D70.0D7M9D7_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.7__2404__AT4G18890.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18890.11e-166BES1/BZR1 homolog 3