PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 491858
Common NameARALYDRAFT_491858
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CPP
Protein Properties Length: 602aa    MW: 63888.6 Da    PI: 7.9813
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
491858genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.71.3e-14125164141
     TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
             ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ +
  491858 125 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVD 164
             589**************************.********986 PP

2TCR50.63.7e-16210249140
     TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
             k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  491858 210 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNFE 249
             589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.0E-16125165IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.427126250IPR005172CRC domain
PfamPF036387.6E-11127162IPR005172CRC domain
SMARTSM011141.5E-19210251IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-12213248IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 602 aa     Download sequence    Send to blast
MGEDGGGGEF PPKKDGVEEG FPTKKPARQL DFTGGSDEQS LSKAAAPTVV ATAVKPVVTS  60
SIPSTIRPGV TIAIGQVRPT LPMATTSNPP SQSQILNAPI RHPKPESPKA RGPRPIVEGR  120
DGTPQKKKQC NCKHSRCLKL YCECFASGTY CDGCNCVNCF NNVDNEPARR EAVEATLERN  180
PFAFRPKIAS SPHGVRDKRE DIGEVVLLGK HNKGCHCKKS GCLKKYCECF QANILCSENC  240
KCLDCKNFEG SEERQALFHG EHANHMAYLQ QAANAAITGA VGSSGFAPSP APKRRKGQEI  300
LFNQATKDSS RLGQFPQVNS GRASGPTSGS SPSPVSRAGG NASSAPSKFV YRSLLADIIQ  360
PHDVRALCSV LVAVAGEAAK TSTDKRNEIE NRVEDQTETS LASSAQDQPQ GDNDAADMEM  420
VATDGNQADK SGAEESNSDG ADASKGNPLS PATLALMCDE QDTIFMVAAP SPNGAVDPGG  480
RRTNSQGQSE IYAEQERLVL TKFRDCLSRL ISYAEIKESK CLSLARMHIQ PSATATVKTE  540
NGVQQQVPIV NGASRTNSQP TLNKPQPMQL INTTSASAAA AAATNTHHLH KPPALSEKKD  600
P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-3112725911132Protein lin-54 homolog
5fd3_B2e-3112725911132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap491858
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1186580.0AK118658.1 Arabidopsis thaliana At4g29000 mRNA for putative transcription factor, complete cds, clone: RAFL19-93-A20.
GenBankBT0059310.0BT005931.1 Arabidopsis thaliana At4g29000 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020874783.10.0protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLD7MD610.0D7MD61_ARALL; Uncharacterized protein
STRINGfgenesh2_kg.7__1291__AT4G29000.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein