PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 484553
Common NameARALYDRAFT_484553
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 158aa    MW: 17596 Da    PI: 8.8082
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
484553genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.65e-4437135199
  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
             +CaaCk+lrrkC++dCv+apyfp e+p kfanvh++FGasnv+k+l+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l+ el+++++
  484553  37 PCAACKFLRRKCTSDCVFAPYFPPEEPTKFANVHRIFGASNVSKILHEVAPHQREDAVNSLAYEAEARLNDPVYGCVGAISVLQRQVLRLQRELEETNA 135
             7*********************************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.2136137IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-4337134IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
RETRSNLFKK LSSRGPFLVT PFKGDIQEKM SNYTNSPCAA CKFLRRKCTS DCVFAPYFPP  60
EEPTKFANVH RIFGASNVSK ILHEVAPHQR EDAVNSLAYE AEARLNDPVY GCVGAISVLQ  120
RQVLRLQREL EETNADLMRY ASCLGSETTS AYGGRRG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-59341418115LOB family transfactor Ramosa2.1
5ly0_B7e-59341418115LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap484553
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2373360.0AC237336.1 Arabidopsis lyrata clone JGIFAFI-69G3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292048.27e-95LOW QUALITY PROTEIN: LOB domain-containing protein 25, partial
SwissprotQ8L8Q31e-92LBD25_ARATH; LOB domain-containing protein 25
TrEMBLD7LPI91e-113D7LPI9_ARALL; LOB domain-containing protein 25 (Fragment)
STRINGfgenesh2_kg.5__545__AT3G27650.11e-114(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.12e-81LOB domain-containing protein 25
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]