PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 483104
Common NameARALYDRAFT_483104
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 201aa    MW: 21570.6 Da    PI: 8.594
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
483104genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.15.5e-42201191100
  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
             +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq++ l+ael ++++e
  483104  20 PCAACKLLRRRCAQECPFSPYFSPHEPHKFASVHKVFGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPVYGCMGAISALQQQVQALQAELTAVRSE 119
             7**********************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.90719120IPR004883Lateral organ boundaries, LOB
PfamPF031953.6E-4220117IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MAGIRRPMSG PPGTLNTITP CAACKLLRRR CAQECPFSPY FSPHEPHKFA SVHKVFGASN  60
VSKMLMEVPE SQRADAANSL VYEANVRLRD PVYGCMGAIS ALQQQVQALQ AELTAVRSEI  120
LKYKQREAVA TLIVPSNSQV AGFHNSGGVS VIAPPPQRPS TPPQPTTAHP PPPSSCILSQ  180
PTTRALEYGD IESENNSYFG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-44121233114LOB family transfactor Ramosa2.1
5ly0_B1e-44121233114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap483104
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4478890.0AF447889.1 Arabidopsis thaliana LOB DOMAIN 15 (LBD15) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020882787.11e-146LOB domain-containing protein 15 isoform X2
SwissprotQ8L5T51e-115LBD15_ARATH; LOB domain-containing protein 15
TrEMBLD7LF451e-145D7LF45_ARALL; Uncharacterized protein
STRINGfgenesh2_kg.4__2164__AT2G40470.11e-145(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-108LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]