PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 481945
Common NameARALYDRAFT_481945
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 271aa    MW: 29342 Da    PI: 8.1568
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
481945genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.23.2e-3952150199
  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
             +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++ e++r da++slvyeA+ r+rdP+yG++g i++lq+++++l++el ++++
  481945  52 PCAACKLLRRRCAEECPFSPYFSPHEPHKFAAVHKVFGASNVSKMLLEVGESQRGDAANSLVYEANLRLRDPIYGCMGAISALQHHIQSLQSELTAVRT 150
             7*********************************************************************************************99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.14251152IPR004883Lateral organ boundaries, LOB
PfamPF031954.4E-4052149IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MSREREGFGE YYEIVKKIKK DPTFESTTDH AVMGIRRHVA VPPGTTLNTV TPCAACKLLR  60
RRCAEECPFS PYFSPHEPHK FAAVHKVFGA SNVSKMLLEV GESQRGDAAN SLVYEANLRL  120
RDPIYGCMGA ISALQHHIQS LQSELTAVRT DILRHKYREA TTITSLQNNN NFHNTTTTSS  180
VSCDHHDLGA AILLPPPPPP PPPPRPPRLL SSQPAPPPTP PASLPSPSMV VSSSSSSNSS  240
ATNSMYNPPP SSAAGYSNSL SSDNNVHYFD *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-41451634122LOB family transfactor Ramosa2.1
5ly0_B9e-41451634122LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap481945
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738430.0AB473843.1 Arabidopsis thaliana ASL10 mRNA for ASYMMETRIC LEAVES2-like 10 protein, complete cds.
GenBankAF4478880.0AF447888.1 Arabidopsis thaliana LOB DOMAIN 13 (LBD13) mRNA, complete cds.
GenBankBT0260520.0BT026052.1 Arabidopsis thaliana At2g30340 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002881102.10.0LOB domain-containing protein 13 isoform X2
SwissprotQ9AT611e-139LBD13_ARATH; LOB domain-containing protein 13
TrEMBLD7LBM70.0D7LBM7_ARALL; Uncharacterized protein
STRINGfgenesh2_kg.4__1005__AT2G30340.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.11e-121LOB domain-containing protein 13
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]