PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 481796
Common NameARALYDRAFT_481796
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 343aa    MW: 36905.5 Da    PI: 9.7522
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
481796genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.19.5e-3991150362
  zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
             e +lkcprCds+ntkfCy+nny+l+qPr+fCkaCrryWt+GGalrnvPvGgg+r+nkk +
  481796  91 EGSLKCPRCDSANTKFCYFNNYNLTQPRHFCKACRRYWTRGGALRNVPVGGGCRRNKKGK 150
             56789***************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3775145IPR003851Zinc finger, Dof-type
PfamPF027012.2E-3293148IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.68394148IPR003851Zinc finger, Dof-type
PROSITE patternPS01361096132IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MVFSSVSSFL DPPINWPQSN NHPNHPHHHQ LQENGSLVSG HHQVLSHHFP QNPNPNHHHV  60
DTAATTTVDP SSLNGQAAER ARLAKNSQPP EGSLKCPRCD SANTKFCYFN NYNLTQPRHF  120
CKACRRYWTR GGALRNVPVG GGCRRNKKGK SGNSKSSSSS QNKQSTSMVN ATSPTTTSNV  180
QLQTNSQFPF LPTLQNLTQL GGIGLNLAAI NGNNGGNGNT SSSFLNELGF FHGGNTSGPV  240
MGNNNNNENN IMTSLGSASH FSLFDRTMGL YNFPNEGNMG LSSIGGTRVS QTAPVKMEDN  300
HLGSINRPVS GMTSPGNQSN QYWTGQGLPG SSSNDHHHQH LM*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00281DAPTransfer from AT2G28810Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap481796
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0328770.0BT032877.1 Arabidopsis thaliana unknown protein (At2g28810) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020885267.10.0dof zinc finger protein DOF2.2 isoform X2
SwissprotQ9ZV330.0DOF22_ARATH; Dof zinc finger protein DOF2.2
TrEMBLD7LK870.0D7LK87_ARALL; Dof-type zinc finger domain-containing protein
STRINGfgenesh2_kg.4__856__AT2G28810.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53361749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28810.11e-173Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]