PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 481760
Common NameARALYDRAFT_481760
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 231aa    MW: 25149.4 Da    PI: 4.5493
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
481760genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601377e-43541531100
  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
             +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r+da++s+vyeA ar+rdPvyG++g i +lq+q+++l+a+la+++ e
  481760  54 PCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHRVFGASNIIKFLQELPESQRTDAVNSMVYEAGARMRDPVYGCAGAIYHLQRQVSELQAQLAKTQVE 153
             7**********************************************************************************************99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.32353154IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-4254151IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MEITGGVATP TASVVAVATV AETKTPVTSP SPTSSPPPPP SPQQPTPPPV VLSPCAACKI  60
LRRRCAEKCV LAPYFPPTDP AKFTIAHRVF GASNIIKFLQ ELPESQRTDA VNSMVYEAGA  120
RMRDPVYGCA GAIYHLQRQV SELQAQLAKT QVELVGMQLQ RSSLLELIYN MEQTKLSAQE  180
QGQQKMSFES SFESGDEFIS SPDEESNDLG FLEDNNNNNS SMSWWDPLWT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-405315510112LOB family transfactor Ramosa2.1
5ly0_B2e-405315510112LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap481760
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738400.0AB473840.1 Arabidopsis thaliana ASL7 mRNA for ASYMMETRIC LEAVES2-like 7 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002880987.21e-171LOB domain-containing protein 11
SwissprotQ9SK081e-138LBD11_ARATH; LOB domain-containing protein 11
TrEMBLD7LJJ71e-170D7LJJ7_ARALL; Uncharacterized protein
STRINGfgenesh2_kg.4__820__AT2G28500.11e-170(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.11e-110LOB domain-containing protein 11