PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 480521
Common NameARALYDRAFT_480521
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 112aa    MW: 13254.3 Da    PI: 7.9543
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
480521genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26068.31.7e-211281475
  DUF260  4 aCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyG 75
            +C + +++C+++C +a+yfp +   +++ +++lFG+ n++k+++++pee+++++++s+++e++a+++dP+y 
  480521 12 VCITRNKNCPQNCEYAKYFPYKF--QYESANELFGTPNIIKMMRHVPEEKKQILATSIIMEGNAWTKDPIYK 81
            8*******************987..89*******************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089113.648107IPR004883Lateral organ boundaries, LOB
PfamPF031954.5E-171281IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
MEPLGNHRPY SVCITRNKNC PQNCEYAKYF PYKFQYESAN ELFGTPNIIK MMRHVPEEKK  60
QILATSIIME GNAWTKDPIY KWWIRCDAKA HLEDYEEKKK TELHLLINDT L*
Cis-element ? help Back to Top
SourceLink
PlantRegMap480521
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738668e-69AB473866.1 Arabidopsis thaliana ASL33 mRNA for ASYMMETRIC LEAVES2-like 33 protein, complete cds.
GenBankDQ0564808e-69DQ056480.1 Arabidopsis thaliana LOB domain family protein (At1g36000) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002865796.27e-49LOB domain-containing protein 5
SwissprotQ9C8V87e-43LBD5_ARATH; LOB domain-containing protein 5
TrEMBLD7L6Z62e-78D7L6Z6_ARALL; Uncharacterized protein
STRINGfgenesh2_kg.3__3222__AT2G19510.14e-79(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122821432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G36000.13e-45LOB domain-containing protein 5