PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 478788
Common NameARALYDRAFT_478788
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 270aa    MW: 30626.2 Da    PI: 6.2231
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
478788genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.43.2e-40361351100
  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
             aCaaCk++rrkCa+dC lapyfp++++++f n+hklFG+sn++k++k+l + e+++am++++++++ara+dPv G++g+i+klq q+e +++el+ + ++
  478788  36 ACAACKYQRRKCAPDCLLAPYFPHDRHRQFLNAHKLFGVSNITKIIKSLTPPEKDAAMHTIMFQSDARASDPVDGCYGIIRKLQYQIEYTRNELEIVLQQ 135
             7*********************************************************************************************998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.39735136IPR004883Lateral organ boundaries, LOB
PfamPF031954.8E-3736132IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MPSGKPSSVF PLHPKPTPLK PSSSSTSNTN SSTNQACAAC KYQRRKCAPD CLLAPYFPHD  60
RHRQFLNAHK LFGVSNITKI IKSLTPPEKD AAMHTIMFQS DARASDPVDG CYGIIRKLQY  120
QIEYTRNELE IVLQQLAMFR DRAHHHHQEP QIQMQEPEDL SSFSSSCDIN NNNSIPYNYA  180
LNHIQEPNQQ QQQYCSSGNN FNGLQEDMWC LQLQDSSTTV NMKAGFIDEC EDVKPVEEVS  240
SERHEFEPHE AFVEQRKLDL PPAQFIISS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-27291394114LOB family transfactor Ramosa2.1
5ly0_B2e-27291394114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap478788
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2373280.0AC237328.1 Arabidopsis lyrata clone JGIFAFI-41L7, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002882855.10.0LOB domain-containing protein 22
RefseqXP_020885980.10.0LOB domain-containing protein 22
RefseqXP_020885981.10.0LOB domain-containing protein 22
SwissprotQ9LRW10.0LBD22_ARATH; LOB domain-containing protein 22
TrEMBLD7L2920.0D7L292_ARALL; LOB domain family protein
STRINGfgenesh2_kg.3__1489__AT3G13850.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64982645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-167LOB domain-containing protein 22
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]