PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 478451
Common NameARALYDRAFT_478451
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 164aa    MW: 17931.6 Da    PI: 6.501
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
478451genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.88.5e-39111101100
  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
             +CaaCk+l+r+C++ C++apyf +++  +fa vhk+FGasnv+kll ++pee+r+++++sl+yeAe+r++dPvyG++g i +lq+++ +l+++la+++++
  478451  11 SCAACKLLKRRCTPTCIFAPYFRSSDLITFAKVHKVFGASNVSKLLGEVPEEQRQETVNSLAYEAEVRLKDPVYGCIGAIASLQKKMLELQHDLAVARTR 110
             6*********************************************************************************************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.67910111IPR004883Lateral organ boundaries, LOB
PfamPF031956.3E-3811108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MRGHEPRSSS SCAACKLLKR RCTPTCIFAP YFRSSDLITF AKVHKVFGAS NVSKLLGEVP  60
EEQRQETVNS LAYEAEVRLK DPVYGCIGAI ASLQKKMLEL QHDLAVARTR LLAHSGVTNQ  120
VSPLDDSPEL AAFLDLVPYS DLMLLDGSSL DAYLYDLGQP PFV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-4261156115LOB family transfactor Ramosa2.1
5ly0_B7e-4261156115LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap478451
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738450.0AB473845.1 Arabidopsis thaliana ASL12 mRNA for ASYMMETRIC LEAVES2-like 12 protein, complete cds.
GenBankAC0733950.0AC073395.6 Arabidopsis thaliana chromosome 3 BAC F11B9 genomic sequence, complete sequence.
GenBankATAC0099910.0AC009991.5 Arabidopsis thaliana chromosome III BAC F9F8 genomic sequence, complete sequence.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002882715.11e-117LOB domain-containing protein 21
SwissprotQ9SRL81e-114LBD21_ARATH; LOB domain-containing protein 21
TrEMBLD7L9U41e-116D7L9U4_ARALL; LOB domain family protein
STRINGfgenesh2_kg.3__1152__AT3G11090.11e-117(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM102552735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.11e-106LOB domain-containing protein 21
Publications ? help Back to Top
  1. Weber AP,Weber KL,Carr K,Wilkerson C,Ohlrogge JB
    Sampling the Arabidopsis transcriptome with massively parallel pyrosequencing.
    Plant Physiol., 2007. 144(1): p. 32-42
    [PMID:17351049]