PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 476427
Common NameARALYDRAFT_476427
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 205aa    MW: 23497.6 Da    PI: 6.1176
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
476427genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.56.4e-40131131101
  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
             aCaaCk++r+kC+k+C lapyfp++++++f n+hklFG+sn++k+lk ++e++r++am+ l+y+A+ara dPv G++++i +l++++e ++ael+ +++++
  476427  13 ACAACKYQRKKCKKNCLLAPYFPQDRSNQFLNAHKLFGVSNITKMLKGIEESQRDIAMENLIYHANARALDPVGGVYSTICDLKRKIEIVQAELNFTRQQI 113
             7***********************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.05812113IPR004883Lateral organ boundaries, LOB
PfamPF031958.1E-3713110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MSLSTLSGGS TTACAACKYQ RKKCKKNCLL APYFPQDRSN QFLNAHKLFG VSNITKMLKG  60
IEESQRDIAM ENLIYHANAR ALDPVGGVYS TICDLKRKIE IVQAELNFTR QQIAMCRSLA  120
QQQQRQRQDL PYGCYSYEHL LQQDEDEYVN VDGFDLQNMQ QHQEMQQQQQ PNPINYEMFL  180
EMPEQTSKVK LEEVKISDQG ETIS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-2691137111LOB family transfactor Ramosa2.1
5ly0_B7e-2691137111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap476427
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738640.0AB473864.1 Arabidopsis thaliana ASL31 mRNA for ASYMMETRIC LEAVES2-like 31 protein, complete cds.
GenBankAC0080170.0AC008017.2 Arabidopsis thaliana chromosome I BAC F3N23 genomic sequence, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002888900.11e-152LOB domain-containing protein 7
SwissprotQ9SSM91e-109LBD7_ARATH; LOB domain-containing protein 7
TrEMBLD7KR591e-150D7KR59_ARALL; LOB domain family protein
STRINGfgenesh2_kg.2__1557__AT1G72980.11e-151(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM154661417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72980.11e-94LOB domain-containing protein 7