PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 473414
Common NameARALYDRAFT_473414
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 388aa    MW: 43728.4 Da    PI: 8.2373
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
473414genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.93.9e-32213266255
  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
              pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
   473414 213 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 266
              9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15210266IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28211266IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-23213266IPR006447Myb domain, plants
PfamPF002492.6E-7214265IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSK PTSTWQRRRS TTDQEDHEEL DLGFWRRALD SRTSSLVSNS  60
SSKTINHPFQ DLSLSNNSHH QQQQHHHHHP QLLPNCNGSN ILTSFQFPTQ QQQQHLQGFL  120
ARDLNTHLRP IRGIPLYHNP PPHHHRPPPP CFPFDPSSLI PSSSSSSPAL TGNNNSFNTS  180
SVSNPNYHNH HHQTLNRARF MPRFPAKRSM RAPRMRWTTT LHARFVHAVE LLGGHERATP  240
KSVLELMDVK DLTLAHVKSH LQMYRTVKTT DKAAASSGQS DVYENGSSGD NNSDDWMFDM  300
NRKSRDSEEL TNPLEKSNGL WTNSSGEARL HGKLIDNVAE IMLPSEKELD GKCSSYERIS  360
SEEMSSSSIS GTSPFKPNLE FTLGRSH*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0292110.0BT029211.1 Arabidopsis thaliana At1g32240 mRNA, complete cds.
GenBankAY0486890.0AY048689.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI2 (KAN2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002893713.10.0hypothetical protein ARALYDRAFT_473414
SwissprotQ9C6160.0KAN2_ARATH; Probable transcription factor KAN2
TrEMBLD7KHH90.0D7KHH9_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.1__3368__AT1G32240.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-179G2-like family protein