PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 359494
Common NameARALYDRAFT_672259
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NF-YA
Protein Properties Length: 189aa    MW: 21094 Da    PI: 11.3078
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
359494genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.42.1e-3250106158
  CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                +ep++VNaKQyq+Il+RRq+Rakle+++kl +k rkpylheSRh hAl+R+RgsgGrF
     359494  50 NEPIFVNAKQYQAILRRRQRRAKLEAQNKL-IKVRKPYLHESRHLHALKRARGSGGRF 106
                59****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.0E-3648109IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.94949109IPR001289Nuclear transcription factor Y subunit A
PfamPF020457.6E-2751106IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.1E-235274IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068605474IPR018362CCAAT-binding factor, conserved site
PRINTSPR006165.1E-2383106IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
AASWPLHGNV TPHFNGFLSF PYASQHMVQH PQIGGLVPCR VPLPHNIPEN EPIFVNAKQY  60
QAILRRRQRR AKLEAQNKLI KVRKPYLHES RHLHALKRAR GSGGRFLNTK KLQESKSSQA  120
PPFLDPPHVF KNSPGKFRQR DISRGGVGSS GSTTSCSDIT GNNNDMFQQN PQFGFSGYPS  180
NHHVSVLM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-2050126277NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16471RRRQRRAK
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap359494
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4936130.0AB493613.1 Arabidopsis thaliana At3g14020 mRNA for hypothetical protein, partial cds, clone: RAAt3g14020.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002882866.11e-139nuclear transcription factor Y subunit A-6 isoform X1
SwissprotQ9LVJ71e-117NFYA6_ARATH; Nuclear transcription factor Y subunit A-6
TrEMBLD7L2B41e-137D7L2B4_ARALL; Predicted protein
STRINGAl_scaffold_0003_14561e-138(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM147331620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.11e-110nuclear factor Y, subunit A6
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]