PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 350644
Common NameARALYDRAFT_350644
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 329aa    MW: 36363.5 Da    PI: 4.6418
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
350644genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260111.75.2e-3537134198
  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
             +C aCk++rr+C++dC+++ +fp  + ++f+nvh+ FG+++v++ l++l +eer dam+s++ye+++r + Pv G++gvil lq+q++ l+ael +++
  350644  37 PCVACKHQRRRCTPDCIFRLHFPVGRYQDFQNVHRQFGVRRVVENLENLAPEERGDAMKSIIYESNVRSQFPVDGCYGVILYLQNQIALLNAELLRTR 134
             7*******************************************************************************************997766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.59336137IPR004883Lateral organ boundaries, LOB
PfamPF031959.9E-3437133IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MMMMRNRLVF FLILTSVIIL MTSQGSSGVN YGGNIEPCVA CKHQRRRCTP DCIFRLHFPV  60
GRYQDFQNVH RQFGVRRVVE NLENLAPEER GDAMKSIIYE SNVRSQFPVD GCYGVILYLQ  120
NQIALLNAEL LRTRSLLTAV VAASNPSSAF FNPTAANNFF HPSAAANFFY PAANNFFHPS  180
AAANFFYPAV SVESELINPS RNLNANNDDF TRVPANDGTI DFLGMGGYCG NFAYEECVTE  240
TTPLEGAPNN NAQQFLPNTN NLGSSPDNAN ANEALEQEQL GGAPRNNDIP RELSEFLTDE  300
ERSFSEAQDS GDKCASQSMT KKDDFPFP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-21331307104LOB family transfactor Ramosa2.1
5ly0_B1e-21331307104LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap350644
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL3911461e-42AL391146.1 Arabidopsis thaliana DNA chromosome 5, BAC clone F2G14 (ESSA project).
GenBankCP0026881e-42CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002873706.10.0LOB domain-containing protein 6
TrEMBLD7M6R00.0D7M6R0_ARALL; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_60012370.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15060.12e-33LBD family protein