PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 347883
Common NameARALYDRAFT_347883
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 364aa    MW: 40861.5 Da    PI: 4.9719
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
347883genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.74e-38361361101
  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
             aCaaCk++rr+Ca+dC+lapyfpaeqpk f+nvh+lFG++ ++k+l++l+e+++++am+s+++++ +r r PvyG++gv ++lq  +  +++el++++++l
  347883  36 ACAACKYQRRRCAADCPLAPYFPAEQPKLFQNVHRLFGVRSIVKILEKLDETQKPEAMKSIIFQSYVRDRSPVYGCLGVTQQLQYMIWLAEEELKAVNSQL 136
             7**********************************************************************************************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.8635136IPR004883Lateral organ boundaries, LOB
PfamPF031957.8E-3536133IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MSNTKNIHKG LLERFLDLLL IALIIFMTLK GGTSGACAAC KYQRRRCAAD CPLAPYFPAE  60
QPKLFQNVHR LFGVRSIVKI LEKLDETQKP EAMKSIIFQS YVRDRSPVYG CLGVTQQLQY  120
MIWLAEEELK AVNSQLQLYR SQPQNGQNQN QNHNNHNQMI HELGGDNKQQ EDVTSQQLDL  180
GMGLNVHNNQ SNVVTPFFSP LLPVSETQQP QMSYTYSCSE VNNNGYSPPA YNTDSGKEIL  240
TNNNNVWGGQ NRFLYNVNNG GGFSNQNESC HEMKSNNGVM AIQSQLVNLQ MASNHQQVEE  300
DEDAHEYDEI HQFLEIIDDR QSFADSKEAY ASSSGGSLKE QIDEIGENEL RSAATCFSLT  360
SMN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-25321397114LOB family transfactor Ramosa2.1
5ly0_B9e-25321397114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap347883
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738620.0AB473862.1 Arabidopsis thaliana ASL29 mRNA for ASYMMETRIC LEAVES2-like 29 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002877582.10.0LOB domain-containing protein 27
SwissprotQ9STS60.0LBD27_ARATH; LOB domain-containing protein 27
TrEMBLD7LRG70.0D7LRG7_ARALL; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_50012750.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.10.0LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]