PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 328625
Common NameARALYDRAFT_328625
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 771aa    MW: 86047.3 Da    PI: 5.8831
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
328625genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY80.22.3e-25218274259
             --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
    WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
             +DgynWrKYGqK+vk+ + +rsYYrCt+++C++kk +e+s++ ++vvei+++g H he
  328625 218 RDGYNWRKYGQKQVKSPKGSRSYYRCTYTECCAKK-IECSNDSGNVVEIVNKGLHSHE 274
             7********************************98.*********************8 PP

2WRKY96.51.8e-30379436259
             --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
    WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
              Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ e++++v+itY+g Hnh+
  328625 379 GDGYRWRKYGQKMVKGNPHPRNYYRCTSAGCPVRKHIETAVENKTAVIITYKGVHNHD 436
             5********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182901.12E-19213276IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.4E-19214276IPR003657WRKY domain
SMARTSM007743.5E-24217275IPR003657WRKY domain
PfamPF031061.8E-16219273IPR003657WRKY domain
PROSITE profilePS5081116.226219276IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-31363438IPR003657WRKY domain
PROSITE profilePS5081131.984373438IPR003657WRKY domain
SuperFamilySSF1182909.94E-27374438IPR003657WRKY domain
SMARTSM007741.9E-34378437IPR003657WRKY domain
PfamPF031061.6E-23380436IPR003657WRKY domain
HamapMF_0136322.61640743IPR001787Ribosomal protein L21
PfamPF008292.1E-33641741IPR028909Ribosomal protein L21-like
SuperFamilySSF1410913.01E-31641741IPR028909Ribosomal protein L21-like
TIGRFAMsTIGR000614.6E-27641742IPR001787Ribosomal protein L21
PROSITE patternPS011690712734IPR018258Ribosomal protein L21, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006412Biological Processtranslation
GO:0005840Cellular Componentribosome
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0003735Molecular Functionstructural constituent of ribosome
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 771 aa     Download sequence    Send to blast
MISLITHKVH ICFSSFSHFF GRRRNKLHFS CSCFLYKIEK KRQRESSMED TGIDEAKVCT  60
VEMSEKVEPE KELDNGLSQL RDEEESLGAC VEDLHDEAVP ETLGKDQVQG VRENSSVEPN  120
VEDVGEVNET DSVNEIVVSA IVPVDEVEEN RQVETSPSLA ASSDVLTVEP SLSSSDPATA  180
SAAQGLSLVS VPTKQEQRSD SRMVNRLSVT PIPRTPARDG YNWRKYGQKQ VKSPKGSRSY  240
YRCTYTECCA KKIECSNDSG NVVEIVNKGL HSHEPPRKIN FSPREIRVTT AIQPVSEDDT  300
VVEELTIVPS GSDPSASTKE NICESQTIVE RKRHCENEAV EEPEPKRRQD NSQSSDSVSK  360
PGKKNKFVVH AAGDVGICGD GYRWRKYGQK MVKGNPHPRN YYRCTSAGCP VRKHIETAVE  420
NKTAVIITYK GVHNHDMPVP KKRHGPPSSM LVAAAAPTSM RTRPDDQVNI PTSSQCSVGR  480
ESEKQGSEAL DVVCSCSPMA SLRCFRELSR RATTVYSIIQ TRSISSFPGI ELSGTSISHG  540
TVIPNRSLSR NLTWYSLWYR SQDRRFSSNT NDTAEDEESS EGEDEDDDDE EGEDFEDSAE  600
MEVEREYSPA EKVEEAAEIG YKVMGPLKPS ERLFKPYEPV FAIVQIGSHQ FKVSNGDSIF  660
TEKLKFCDIN DKLELTKVLL LGSASQTIIG RPILPDATVH AVVEEHALDE KVLIFKKKRR  720
KNYRRTRGHR QELTKLRITD IQGIEKPEPK IIPKPSKECV TEQSKAELVA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-25369439878Probable WRKY transcription factor 4
2lex_A5e-25369439878Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1715719KKKRR
2715720KKKRRK
3716720KKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0040860.0BT004086.1 Arabidopsis thaliana clone RAFL15-37-C10 (R20909) putative WRKY family transcription factor (At4g30935) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002867320.10.0hypothetical protein ARALYDRAFT_328625
SwissprotP595830.0WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLD7MBK50.0D7MBK5_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_70008520.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.10.0WRKY DNA-binding protein 32