PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 315900
Common NameARALYDRAFT_315900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TCP
Protein Properties Length: 353aa    MW: 40628.7 Da    PI: 8.1416
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
315900genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP1341.4e-411102372133
     TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksaakskksqksa 104
             a+k+drhski+T++g+RdRR+Rls+++a++fFdLqd+LGfdk+sktieWL+ ++k +ik+l +  + s+     ++++ ++++++  k ++ +   +k+++++
  315900 110 AKKRDRHSKICTAQGPRDRRMRLSLQIARKFFDLQDMLGFDKASKTIEWLFSKSKGSIKQLKERVAASE--GGGQDEHLQVDEKE--KDETLKVRVSKRRTKT 208
             789*************************************************************44444..43444444444222..3334444556666666 PP

     TCP 105 asalnlakesrakarararertrekmrik 133
              + + + kesr++ar+rarert  km+++
  315900 209 MESSCKTKESRERARKRARERTMAKMKMR 237
             66688888*******************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.5E-35111236IPR005333Transcription factor, TCP
PROSITE profilePS5136935.859112170IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137010.59216233IPR017888CYC/TB1, R domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MFPSLDTNGY DLFDPFNPTQ TTMLPSFTSY IQSPSSHHHY SSPSFPFSPD FLDSFNESLL  60
INQFLLQQQD AAANVVESPR KLCKKLQLKN NNEKCVDGTT SEQVPRRRMA KKRDRHSKIC  120
TAQGPRDRRM RLSLQIARKF FDLQDMLGFD KASKTIEWLF SKSKGSIKQL KERVAASEGG  180
GQDEHLQVDE KEKDETLKVR VSKRRTKTME SSCKTKESRE RARKRARERT MAKMKMRLFE  240
TSETISDPHQ ETRDQIKITN GEQLLEREHK EQEWSHTNVN MVEYQMDSVS IIEKFLGLTS  300
DSSTSSIFGD SEECHTSLSS IIGMSTPREH NTTVDEEKSP ISSFSLYDYL CY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1218228RERARKRARER
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that prevents axillary bud outgrowth. May also delay early axillary bud development. Probably involved in the auxin-induced control of apical dominance. {ECO:0000269|PubMed:17307924}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap315900
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed transiently after shoot apical meristem (SAM) decapitation (release from apical dominance). {ECO:0000269|PubMed:17307924}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4085610.0AM408561.1 Arabidopsis thaliana mRNA for BRANCHED2 (brc2 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002888684.10.0transcription factor TCP12 isoform X2
SwissprotA0AQW40.0TCP12_ARATH; Transcription factor TCP12
TrEMBLD7KWG50.0D7KWG5_ARALL; BRANCHED2
STRINGfgenesh1_pm.C_scaffold_20009330.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116322533
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68800.11e-161TCP domain protein 12