PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 312884
Common NameARALYDRAFT_312884
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 648aa    MW: 72399.1 Da    PI: 5.9868
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
312884genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.99.2e-08332394163
             XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
  bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
             e+e +r rr   NRe+Ar   +R++a +eeL +k++ L+ eN+ L+ e +   ke ++l++ +
  312884 332 EREERRIRRILANRESARQTIRRRQAMCEELSKKAADLTYENENLRREKDWALKEFQSLETIN 394
             78899******************************************9999999999888766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.26458IPR017877Myb-like domain
SMARTSM007173.2E-6860IPR001005SANT/Myb domain
SuperFamilySSF466891.04E-101164IPR009057Homeodomain-like
CDDcd001670.00161854No hitNo description
PfamPF001701.2E-7332394IPR004827Basic-leucine zipper domain
SMARTSM003382.7E-9332396IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.979334397IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.7E-6336391No hitNo description
Gene3DG3DSA:1.20.5.1706.1E-7336402No hitNo description
CDDcd147021.89E-12342388No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 648 aa     Download sequence    Send to blast
MASSSMSSSS SWTSKQNKMF ERALAVYDKD TPDRWQNVAK AVGSKSAEEV KRHYDILVED  60
LMNIEQDLIN EEYENPVKSV TLMNFQIKPN KTRKTRKYIV DKLKKIYELP LMAKISVAVL  120
LSVLLIVSIN SVDILAEEQP TVGQRIDSAV TGVTNAFNEH GGPQAVDTVS STVKSVYGWF  180
SEKAKYLEPI SSSCCSSSSS GEEDTAAANM TEMEAAEALA DLAQLAIMRE EVFESAASWG  240
SKGKRVRKRV KTESPPSDSL LKPPDSETLP TPDLAEERLV KEEEEEEVQP ITKAPVKTEM  300
NGETPKLNLA STLRCSRSNG CGRSRQNLSE AEREERRIRR ILANRESARQ TIRRRQAMCE  360
ELSKKAADLT YENENLRREK DWALKEFQSL ETINKHLKEQ VSKSVKPDTK EPEESTKPSQ  420
VDMSTSSTPF YFYNQNPYQL FCWPHVTQSS NPTISPLEFA TSGGPSAKSM TSQEHENPAD  480
DNGQKTHFYV VPCPWFLPPP DQSNSVPFGL QNTQRGTFSN GHHIDDSSAR PIEVTETPRS  540
HLPTRIKEED SGSPETRPLY DLNESATEVL SEGGDDFPIT QQDYSLKHED VSETTNGVTL  600
MPPGHHVLIS LPGKKQGSLA AAEARKRRKE LTRLKNLHGR QCRMQVG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A6e-21365264RADIALIS
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1624629RKRRKE
Cis-element ? help Back to Top
SourceLink
PlantRegMap312884
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0998750.0AY099875.1 Arabidopsis thaliana unknown protein (At1g19490) mRNA, complete cds.
GenBankBT0003190.0BT000319.1 Arabidopsis thaliana unknown protein (At1g19490) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020870087.10.0uncharacterized protein LOC9326406
TrEMBLD7KI330.0D7KI33_ARALL; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_10016640.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112112428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.10.0bZIP family protein