PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 311843
Common NameARALYDRAFT_311843
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 191aa    MW: 21377.2 Da    PI: 4.9952
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
311843genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.13e-4333131199
  DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
             +CaaCk+lrr+Ca+ Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r+da++s+vyeAear+rdPvyG++g i +lq+q+++l+a+la+ + 
  311843  33 PCAACKILRRRCAERCVLAPYFPPTDPAKFTIAHRVFGASNIIKFLQELPESQRTDAVNSMVYEAEARIRDPVYGCAGAIYHLQRQVSELQAQLAKSQV 131
             7*********************************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.38932133IPR004883Lateral organ boundaries, LOB
PfamPF031956.2E-4333129IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MESKSDASAA TTPIISSSSS PPPPFSPRVV LSPCAACKIL RRRCAERCVL APYFPPTDPA  60
KFTIAHRVFG ASNIIKFLQE LPESQRTDAV NSMVYEAEAR IRDPVYGCAG AIYHLQRQVS  120
ELQAQLAKSQ VEIVNMQFQR SNLLELLYKM DQQNQEQDNI LSFESNDLGF LEDNSNTNSS  180
MLWWDPLWTC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-423213410112LOB family transfactor Ramosa2.1
5ly0_B4e-423213410112LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap311843
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738410.0AB473841.1 Arabidopsis thaliana ASL8 mRNA for ASYMMETRIC LEAVES2-like 8 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020867785.11e-140LOB domain-containing protein 1
RefseqXP_020867786.11e-140LOB domain-containing protein 1
RefseqXP_020867787.11e-140LOB domain-containing protein 1
SwissprotQ9LQR01e-119LBD1_ARATH; LOB domain-containing protein 1
TrEMBLD7KHW81e-139D7KHW8_ARALL; LOB domain protein 1
STRINGfgenesh1_pm.C_scaffold_10006231e-140(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-121LOB domain-containing protein 1